Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 2598665..2599376 | Replicon | chromosome |
Accession | NZ_CP120376 | ||
Organism | Pseudomonas nitroreducens strain L4 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | P3T65_RS12045 | Protein ID | WP_226046080.1 |
Coordinates | 2598665..2599099 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | P3T65_RS12050 | Protein ID | WP_226046081.1 |
Coordinates | 2599104..2599376 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3T65_RS12040 (P3T65_12040) | 2596585..2598627 | + | 2043 | WP_277369311.1 | exodeoxyribonuclease V subunit alpha | - |
P3T65_RS12045 (P3T65_12045) | 2598665..2599099 | - | 435 | WP_226046080.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P3T65_RS12050 (P3T65_12050) | 2599104..2599376 | - | 273 | WP_226046081.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
P3T65_RS12055 (P3T65_12055) | 2599510..2602356 | + | 2847 | WP_065086150.1 | ATP-binding protein | - |
P3T65_RS12060 (P3T65_12060) | 2602335..2603531 | + | 1197 | WP_024767535.1 | EAL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15552.78 Da Isoelectric Point: 4.8185
>T274938 WP_226046080.1 NZ_CP120376:c2599099-2598665 [Pseudomonas nitroreducens]
VATPVTYMLDTNICSFIMRQNPPQVLQRLQKAAESGNRLVISAITHAELRYGAASPKAPKAVAAWIDALVQRLDDVLPWD
IDAVDSSAKLMSLLLDSGTPIGPNDTGIASHALATDCVIVTNNTREFRRVPGLVVEDWCNSEPA
VATPVTYMLDTNICSFIMRQNPPQVLQRLQKAAESGNRLVISAITHAELRYGAASPKAPKAVAAWIDALVQRLDDVLPWD
IDAVDSSAKLMSLLLDSGTPIGPNDTGIASHALATDCVIVTNNTREFRRVPGLVVEDWCNSEPA
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|