Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 1370519..1371024 | Replicon | chromosome |
Accession | NZ_CP120376 | ||
Organism | Pseudomonas nitroreducens strain L4 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A1B8TFU7 |
Locus tag | P3T65_RS06295 | Protein ID | WP_024763697.1 |
Coordinates | 1370519..1370800 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1B8V0Q7 |
Locus tag | P3T65_RS06300 | Protein ID | WP_024763698.1 |
Coordinates | 1370797..1371024 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3T65_RS06270 (P3T65_06270) | 1366420..1367370 | + | 951 | WP_277369135.1 | alpha/beta hydrolase | - |
P3T65_RS06275 (P3T65_06275) | 1367444..1368472 | + | 1029 | WP_231387660.1 | AraC family transcriptional regulator | - |
P3T65_RS06280 (P3T65_06280) | 1368474..1368929 | - | 456 | WP_084358453.1 | GNAT family N-acetyltransferase | - |
P3T65_RS06285 (P3T65_06285) | 1368973..1369890 | - | 918 | WP_024763695.1 | LysR family transcriptional regulator | - |
P3T65_RS06290 (P3T65_06290) | 1369988..1370275 | + | 288 | WP_024763696.1 | DUF2218 domain-containing protein | - |
P3T65_RS06295 (P3T65_06295) | 1370519..1370800 | - | 282 | WP_024763697.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P3T65_RS06300 (P3T65_06300) | 1370797..1371024 | - | 228 | WP_024763698.1 | CopG family ribbon-helix-helix protein | Antitoxin |
P3T65_RS06305 (P3T65_06305) | 1371265..1372650 | + | 1386 | WP_038803461.1 | sodium:solute symporter | - |
P3T65_RS06310 (P3T65_06310) | 1372678..1373634 | + | 957 | WP_024763699.1 | agmatinase | - |
P3T65_RS06315 (P3T65_06315) | 1373710..1374636 | + | 927 | WP_024763700.1 | LysR family transcriptional regulator | - |
P3T65_RS06320 (P3T65_06320) | 1374633..1375346 | + | 714 | WP_024763701.1 | phytanoyl-CoA dioxygenase family protein | - |
P3T65_RS06325 (P3T65_06325) | 1375362..1375763 | + | 402 | WP_024763702.1 | GFA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10323.76 Da Isoelectric Point: 5.6558
>T274937 WP_024763697.1 NZ_CP120376:c1370800-1370519 [Pseudomonas nitroreducens]
MSLQWTHKAAADLDAIYDHYVVLIGPEKALRAIQDIVEQVSPLANLDLSSSGVPSEVPGVRELSVERWPYQAAFRVKGRS
VQILRIDRVDNPG
MSLQWTHKAAADLDAIYDHYVVLIGPEKALRAIQDIVEQVSPLANLDLSSSGVPSEVPGVRELSVERWPYQAAFRVKGRS
VQILRIDRVDNPG
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B8TFU7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B8V0Q7 |