Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 116435..116970 | Replicon | chromosome |
Accession | NZ_CP120376 | ||
Organism | Pseudomonas nitroreducens strain L4 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | P3T65_RS00590 | Protein ID | WP_277368886.1 |
Coordinates | 116695..116970 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0F0DTW6 |
Locus tag | P3T65_RS00585 | Protein ID | WP_024762620.1 |
Coordinates | 116435..116704 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3T65_RS00560 (P3T65_00560) | 111613..112740 | - | 1128 | WP_277368885.1 | GGDEF domain-containing protein | - |
P3T65_RS00565 (P3T65_00565) | 112993..114516 | + | 1524 | WP_024762623.1 | fumarate hydratase | - |
P3T65_RS00570 (P3T65_00570) | 114648..114950 | - | 303 | WP_017519692.1 | ribbon-helix-helix domain-containing protein | - |
P3T65_RS00575 (P3T65_00575) | 114984..115565 | - | 582 | WP_065084442.1 | DJ-1/PfpI family protein | - |
P3T65_RS00580 (P3T65_00580) | 115669..116247 | - | 579 | WP_024762621.1 | DUF2846 domain-containing protein | - |
P3T65_RS00585 (P3T65_00585) | 116435..116704 | + | 270 | WP_024762620.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
P3T65_RS00590 (P3T65_00590) | 116695..116970 | + | 276 | WP_277368886.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P3T65_RS00595 (P3T65_00595) | 116990..117577 | - | 588 | WP_065084471.1 | GNAT family acetyltransferase | - |
P3T65_RS00600 (P3T65_00600) | 117761..118999 | - | 1239 | WP_205896507.1 | acyltransferase | - |
P3T65_RS00605 (P3T65_00605) | 119088..120245 | - | 1158 | WP_024762616.1 | phospholipase D-like domain-containing protein | - |
P3T65_RS00610 (P3T65_00610) | 120242..120817 | - | 576 | WP_024762615.1 | YceI family protein | - |
P3T65_RS00615 (P3T65_00615) | 120929..121834 | - | 906 | WP_170859783.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10493.07 Da Isoelectric Point: 9.6182
>T274936 WP_277368886.1 NZ_CP120376:116695-116970 [Pseudomonas nitroreducens]
MRVIYAPAALRDLDRLRRFLRETNPTAARRAGQIILQATQALGAYPQMGRLIDDLPIEFREWPIDFGDSGYLARYHIDGE
TLVTLAIRHQR
MRVIYAPAALRDLDRLRRFLRETNPTAARRAGQIILQATQALGAYPQMGRLIDDLPIEFREWPIDFGDSGYLARYHIDGE
TLVTLAIRHQR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|