Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 1765524..1766059 | Replicon | chromosome |
| Accession | NZ_CP120374 | ||
| Organism | Sinorhizobium garamanticum strain LMG 24692 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PZN02_RS28040 | Protein ID | WP_280662207.1 |
| Coordinates | 1765524..1765799 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PZN02_RS28045 | Protein ID | WP_280662208.1 |
| Coordinates | 1765799..1766059 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZN02_RS28020 (PZN02_005606) | 1760844..1761248 | - | 405 | WP_280662203.1 | DoxX family protein | - |
| PZN02_RS28025 (PZN02_005607) | 1761669..1764506 | + | 2838 | WP_280662204.1 | DNA translocase FtsK | - |
| PZN02_RS28030 (PZN02_005608) | 1764661..1764894 | + | 234 | WP_280662205.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| PZN02_RS28035 (PZN02_005609) | 1764891..1765295 | + | 405 | WP_280662206.1 | type II toxin-antitoxin system VapC family toxin | - |
| PZN02_RS28040 (PZN02_005610) | 1765524..1765799 | - | 276 | WP_280662207.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PZN02_RS28045 (PZN02_005611) | 1765799..1766059 | - | 261 | WP_280662208.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| PZN02_RS28050 (PZN02_005612) | 1766151..1767038 | - | 888 | WP_280662209.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| PZN02_RS28055 (PZN02_005613) | 1767035..1767820 | - | 786 | WP_280662210.1 | hypothetical protein | - |
| PZN02_RS28060 (PZN02_005614) | 1767831..1768418 | - | 588 | WP_280663306.1 | protein-S-isoprenylcysteine O-methyltransferase | - |
| PZN02_RS28065 (PZN02_005615) | 1768569..1769159 | - | 591 | WP_280662211.1 | hypothetical protein | - |
| PZN02_RS28070 (PZN02_005616) | 1769313..1769450 | - | 138 | WP_280663307.1 | ABC transporter | - |
| PZN02_RS28075 (PZN02_005617) | 1769641..1770237 | - | 597 | WP_280662212.1 | L,D-transpeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10908.52 Da Isoelectric Point: 10.2942
>T274935 WP_280662207.1 NZ_CP120374:c1765799-1765524 [Sinorhizobium garamanticum]
MKLHWTTKSVSDLGRLYDFLAPVNRQAEARTVQALASAPRRLLEQPRIGERLEEFDPRAVRRILVSHYEMRYEITQSTIY
VLRLWHTREDR
MKLHWTTKSVSDLGRLYDFLAPVNRQAEARTVQALASAPRRLLEQPRIGERLEEFDPRAVRRILVSHYEMRYEITQSTIY
VLRLWHTREDR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|