Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 1629370..1630010 | Replicon | chromosome |
| Accession | NZ_CP120374 | ||
| Organism | Sinorhizobium garamanticum strain LMG 24692 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PZN02_RS27450 | Protein ID | WP_280662097.1 |
| Coordinates | 1629370..1629756 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PZN02_RS27455 | Protein ID | WP_280662098.1 |
| Coordinates | 1629756..1630010 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZN02_RS27420 (PZN02_005486) | 1625181..1625948 | + | 768 | WP_280662092.1 | 3-hydroxyacyl-CoA dehydrogenase | - |
| PZN02_RS27425 (PZN02_005487) | 1626041..1626298 | - | 258 | WP_280662093.1 | DUF1127 domain-containing protein | - |
| PZN02_RS27430 (PZN02_005488) | 1626410..1627918 | + | 1509 | WP_280662094.1 | winged helix-turn-helix domain-containing tetratricopeptide repeat protein | - |
| PZN02_RS27435 (PZN02_005489) | 1628059..1628451 | - | 393 | WP_280662095.1 | GFA family protein | - |
| PZN02_RS27440 (PZN02_005490) | 1628694..1628987 | + | 294 | WP_280662096.1 | DUF2934 domain-containing protein | - |
| PZN02_RS27445 (PZN02_005491) | 1629115..1629326 | - | 212 | Protein_1492 | integrase | - |
| PZN02_RS27450 (PZN02_005492) | 1629370..1629756 | - | 387 | WP_280662097.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PZN02_RS27455 (PZN02_005493) | 1629756..1630010 | - | 255 | WP_280662098.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PZN02_RS27460 (PZN02_005494) | 1630321..1631466 | - | 1146 | WP_280662099.1 | HPP family protein | - |
| PZN02_RS27465 (PZN02_005495) | 1631661..1631993 | + | 333 | WP_280662100.1 | hypothetical protein | - |
| PZN02_RS27470 (PZN02_005496) | 1632210..1633286 | - | 1077 | WP_280662101.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14018.93 Da Isoelectric Point: 4.6381
>T274934 WP_280662097.1 NZ_CP120374:c1629756-1629370 [Sinorhizobium garamanticum]
MVIDTSAIVALAFNEPEAETYERKVVDAPRRFISAATVLELAIVIEARLGEAGAAELDLWLYKAGVEIVAVDAEQIAVAR
RAWRSYGKGRHPAGLNYGDCFSYALAKTRNEPLLFKGDDFSRTDIEAA
MVIDTSAIVALAFNEPEAETYERKVVDAPRRFISAATVLELAIVIEARLGEAGAAELDLWLYKAGVEIVAVDAEQIAVAR
RAWRSYGKGRHPAGLNYGDCFSYALAKTRNEPLLFKGDDFSRTDIEAA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|