Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 585044..585720 | Replicon | plasmid unnamed |
Accession | NZ_CP120372 | ||
Organism | Sinorhizobium numidicum strain LMG 27395 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PYH38_RS31930 | Protein ID | WP_280736330.1 |
Coordinates | 585298..585720 (+) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A2A6LPC6 |
Locus tag | PYH38_RS31925 | Protein ID | WP_010875326.1 |
Coordinates | 585044..585301 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYH38_RS31900 | 581479..581566 | + | 88 | Protein_548 | plasmid stability protein stbC | - |
PYH38_RS31905 (PYH38_006380) | 581784..583343 | - | 1560 | WP_280736325.1 | E2 ligase fold family C protein | - |
PYH38_RS31910 (PYH38_006381) | 583346..583786 | - | 441 | WP_280736327.1 | Mov34/MPN/PAD-1 family protein | - |
PYH38_RS31915 (PYH38_006382) | 583831..584436 | - | 606 | WP_280736328.1 | hypothetical protein | - |
PYH38_RS31920 (PYH38_006383) | 584429..584725 | - | 297 | WP_280736329.1 | DUF2604 domain-containing protein | - |
PYH38_RS31925 (PYH38_006384) | 585044..585301 | + | 258 | WP_010875326.1 | plasmid stability protein stbC | Antitoxin |
PYH38_RS31930 (PYH38_006385) | 585298..585720 | + | 423 | WP_280736330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PYH38_RS31935 (PYH38_006386) | 585938..587310 | - | 1373 | Protein_555 | ISNCY family transposase | - |
PYH38_RS31940 (PYH38_006387) | 587426..587614 | - | 189 | Protein_556 | IS30 family transposase | - |
PYH38_RS31945 (PYH38_006388) | 588039..588371 | + | 333 | WP_280736331.1 | hypothetical protein | - |
PYH38_RS31950 (PYH38_006389) | 589704..590543 | + | 840 | WP_280736332.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | htpB | 1..629446 | 629446 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15121.44 Da Isoelectric Point: 4.6812
>T274932 WP_280736330.1 NZ_CP120372:585298-585720 [Sinorhizobium numidicum]
MIVLDTNVISELWKAEPDRTVLAWIDAQMIETLYLSAITVAELRFGLAAMPAGKRRTIFQNRLEGEVLPALAGRVLPFDL
DASRSYADLMAQAKTSGKAIGKADGYIAATAVAHGFMVATRDTSPFEAAGLDIINPWEPA
MIVLDTNVISELWKAEPDRTVLAWIDAQMIETLYLSAITVAELRFGLAAMPAGKRRTIFQNRLEGEVLPALAGRVLPFDL
DASRSYADLMAQAKTSGKAIGKADGYIAATAVAHGFMVATRDTSPFEAAGLDIINPWEPA
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|