Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/NGN_SP-Phd |
| Location | 163189..163850 | Replicon | plasmid unnamed |
| Accession | NZ_CP120372 | ||
| Organism | Sinorhizobium numidicum strain LMG 27395 | ||
Toxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PYH38_RS29920 | Protein ID | WP_280736488.1 |
| Coordinates | 163189..163596 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PYH38_RS29925 | Protein ID | WP_280736490.1 |
| Coordinates | 163596..163850 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH38_RS29895 (PYH38_005979) | 158945..159859 | + | 915 | WP_280736483.1 | nucleotidyltransferase and HEPN domain-containing protein | - |
| PYH38_RS29900 (PYH38_005980) | 159877..160275 | - | 399 | WP_280736649.1 | hypothetical protein | - |
| PYH38_RS29905 (PYH38_005981) | 160181..161098 | - | 918 | WP_280736484.1 | recombinase family protein | - |
| PYH38_RS29910 (PYH38_005982) | 161699..161950 | - | 252 | WP_280736485.1 | hypothetical protein | - |
| PYH38_RS29915 (PYH38_005983) | 162077..163066 | - | 990 | WP_280736615.1 | site-specific integrase | - |
| PYH38_RS29920 (PYH38_005984) | 163189..163596 | - | 408 | WP_280736488.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PYH38_RS29925 (PYH38_005985) | 163596..163850 | - | 255 | WP_280736490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PYH38_RS29930 (PYH38_005986) | 164086..165039 | + | 954 | WP_280736491.1 | DUF1403 family protein | - |
| PYH38_RS29935 (PYH38_005987) | 165042..165731 | + | 690 | WP_280663344.1 | SMC-Scp complex subunit ScpB | - |
| PYH38_RS29940 (PYH38_005988) | 166017..166337 | + | 321 | WP_280736616.1 | DUF1476 domain-containing protein | - |
| PYH38_RS29945 (PYH38_005989) | 166628..167089 | + | 462 | WP_280736492.1 | hypothetical protein | - |
| PYH38_RS29950 (PYH38_005990) | 167211..167489 | - | 279 | WP_280663341.1 | hypothetical protein | - |
| PYH38_RS29955 (PYH38_005991) | 167632..168072 | - | 441 | WP_280663340.1 | DUF2267 domain-containing protein | - |
| PYH38_RS29960 (PYH38_005992) | 168286..168597 | - | 312 | Protein_160 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | htpB | 1..629446 | 629446 | |
| - | flank | IS/Tn | - | - | 168274..168597 | 323 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14884.11 Da Isoelectric Point: 6.6458
>T274931 WP_280736488.1 NZ_CP120372:c163596-163189 [Sinorhizobium numidicum]
MYLVDTNIVSEARRGAPQAVAWLRSVDPLSIHLSALTLGEIMRGIALKQKSDPKAAAHLAEWLRKLRHDHGDRILPVTDQ
IAVEWGRIAAIRPRGDIDGLLAATAVVHDLILVTRNVKDFEDTDASVINPWETPA
MYLVDTNIVSEARRGAPQAVAWLRSVDPLSIHLSALTLGEIMRGIALKQKSDPKAAAHLAEWLRKLRHDHGDRILPVTDQ
IAVEWGRIAAIRPRGDIDGLLAATAVVHDLILVTRNVKDFEDTDASVINPWETPA
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|