Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 2204984..2205519 Replicon chromosome
Accession NZ_CP120370
Organism Sinorhizobium numidicum strain LMG 27395

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PYH38_RS10465 Protein ID WP_280732473.1
Coordinates 2204984..2205259 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PYH38_RS10470 Protein ID WP_280731347.1
Coordinates 2205259..2205519 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYH38_RS10430 (PYH38_002085) 2200431..2201105 - 675 WP_280731344.1 DUF6064 family protein -
PYH38_RS10435 (PYH38_002086) 2201140..2202057 - 918 WP_280731345.1 aldo/keto reductase -
PYH38_RS10440 (PYH38_002087) 2202263..2202367 - 105 Protein_2077 VOC family protein -
PYH38_RS10445 (PYH38_002088) 2202388..2202711 - 324 Protein_2078 integrase -
PYH38_RS10450 (PYH38_002089) 2202870..2203076 + 207 WP_280732472.1 cold-shock protein -
PYH38_RS10455 (PYH38_002090) 2203439..2203804 + 366 WP_280731346.1 hypothetical protein -
PYH38_RS10460 (PYH38_002091) 2203793..2204929 - 1137 Protein_2081 tyrosine-type recombinase/integrase -
PYH38_RS10465 (PYH38_002092) 2204984..2205259 - 276 WP_280732473.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PYH38_RS10470 (PYH38_002093) 2205259..2205519 - 261 WP_280731347.1 ribbon-helix-helix domain-containing protein Antitoxin
PYH38_RS10475 (PYH38_002094) 2205680..2206066 - 387 WP_280731348.1 type II toxin-antitoxin system VapC family toxin -
PYH38_RS10480 (PYH38_002095) 2206066..2206320 - 255 WP_280731349.1 type II toxin-antitoxin system VapB family antitoxin -
PYH38_RS10485 (PYH38_002096) 2206536..2206688 - 153 Protein_2086 N-acetyltransferase -
PYH38_RS10490 (PYH38_002097) 2206889..2207158 + 270 WP_280731350.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
PYH38_RS10495 (PYH38_002098) 2207151..2207411 + 261 WP_280731351.1 hypothetical protein -
PYH38_RS10500 (PYH38_002099) 2207935..2208399 + 465 Protein_2089 hypothetical protein -
PYH38_RS10505 (PYH38_002100) 2208821..2209060 + 240 WP_280732474.1 type II toxin-antitoxin system ParD family antitoxin -
PYH38_RS10510 (PYH38_002101) 2209057..2209386 + 330 WP_280731352.1 type II toxin-antitoxin system RelE/ParE family toxin -
PYH38_RS10515 (PYH38_002102) 2209614..2209904 - 291 WP_280731353.1 DUF1330 domain-containing protein -
PYH38_RS10520 (PYH38_002103) 2209970..2210455 + 486 WP_280731354.1 MarR family winged helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(6-43)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10876.46 Da        Isoelectric Point: 9.5559

>T274929 WP_280732473.1 NZ_CP120370:c2205259-2204984 [Sinorhizobium numidicum]
MKLEWSSKAVSDLGRLYDFLALVNRQAAVRTVQSLTSAPTSLLEQPWIGERLEEFNPREVRRIVVGHYEMRYEIRQSTIY
VLRLWHTREER

Download         Length: 276 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9725.08 Da        Isoelectric Point: 5.1239

>AT274929 WP_280731347.1 NZ_CP120370:c2205519-2205259 [Sinorhizobium numidicum]
METKVVTAHVPLPLAEKVDQIAARLERSRGWIVKQALAAWIDQEEERRRMTLEALADVDSGRVIDHQSVQAWADSLDSDK
PRPLPL

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References