Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 2204984..2205519 | Replicon | chromosome |
| Accession | NZ_CP120370 | ||
| Organism | Sinorhizobium numidicum strain LMG 27395 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PYH38_RS10465 | Protein ID | WP_280732473.1 |
| Coordinates | 2204984..2205259 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PYH38_RS10470 | Protein ID | WP_280731347.1 |
| Coordinates | 2205259..2205519 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH38_RS10430 (PYH38_002085) | 2200431..2201105 | - | 675 | WP_280731344.1 | DUF6064 family protein | - |
| PYH38_RS10435 (PYH38_002086) | 2201140..2202057 | - | 918 | WP_280731345.1 | aldo/keto reductase | - |
| PYH38_RS10440 (PYH38_002087) | 2202263..2202367 | - | 105 | Protein_2077 | VOC family protein | - |
| PYH38_RS10445 (PYH38_002088) | 2202388..2202711 | - | 324 | Protein_2078 | integrase | - |
| PYH38_RS10450 (PYH38_002089) | 2202870..2203076 | + | 207 | WP_280732472.1 | cold-shock protein | - |
| PYH38_RS10455 (PYH38_002090) | 2203439..2203804 | + | 366 | WP_280731346.1 | hypothetical protein | - |
| PYH38_RS10460 (PYH38_002091) | 2203793..2204929 | - | 1137 | Protein_2081 | tyrosine-type recombinase/integrase | - |
| PYH38_RS10465 (PYH38_002092) | 2204984..2205259 | - | 276 | WP_280732473.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PYH38_RS10470 (PYH38_002093) | 2205259..2205519 | - | 261 | WP_280731347.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| PYH38_RS10475 (PYH38_002094) | 2205680..2206066 | - | 387 | WP_280731348.1 | type II toxin-antitoxin system VapC family toxin | - |
| PYH38_RS10480 (PYH38_002095) | 2206066..2206320 | - | 255 | WP_280731349.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PYH38_RS10485 (PYH38_002096) | 2206536..2206688 | - | 153 | Protein_2086 | N-acetyltransferase | - |
| PYH38_RS10490 (PYH38_002097) | 2206889..2207158 | + | 270 | WP_280731350.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| PYH38_RS10495 (PYH38_002098) | 2207151..2207411 | + | 261 | WP_280731351.1 | hypothetical protein | - |
| PYH38_RS10500 (PYH38_002099) | 2207935..2208399 | + | 465 | Protein_2089 | hypothetical protein | - |
| PYH38_RS10505 (PYH38_002100) | 2208821..2209060 | + | 240 | WP_280732474.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| PYH38_RS10510 (PYH38_002101) | 2209057..2209386 | + | 330 | WP_280731352.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PYH38_RS10515 (PYH38_002102) | 2209614..2209904 | - | 291 | WP_280731353.1 | DUF1330 domain-containing protein | - |
| PYH38_RS10520 (PYH38_002103) | 2209970..2210455 | + | 486 | WP_280731354.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10876.46 Da Isoelectric Point: 9.5559
>T274929 WP_280732473.1 NZ_CP120370:c2205259-2204984 [Sinorhizobium numidicum]
MKLEWSSKAVSDLGRLYDFLALVNRQAAVRTVQSLTSAPTSLLEQPWIGERLEEFNPREVRRIVVGHYEMRYEIRQSTIY
VLRLWHTREER
MKLEWSSKAVSDLGRLYDFLALVNRQAAVRTVQSLTSAPTSLLEQPWIGERLEEFNPREVRRIVVGHYEMRYEIRQSTIY
VLRLWHTREER
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|