Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 301255..301829 | Replicon | chromosome |
| Accession | NZ_CP120370 | ||
| Organism | Sinorhizobium numidicum strain LMG 27395 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PYH38_RS01425 | Protein ID | WP_280731678.1 |
| Coordinates | 301255..301638 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PYH38_RS01430 | Protein ID | WP_280731679.1 |
| Coordinates | 301635..301829 (-) | Length | 65 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH38_RS01400 (PYH38_000280) | 296729..297985 | + | 1257 | WP_280731674.1 | ribulose-bisphosphate carboxylase large subunit family protein | - |
| PYH38_RS01405 (PYH38_000281) | 298019..299353 | + | 1335 | WP_280731676.1 | four-carbon acid sugar kinase family protein | - |
| PYH38_RS01410 (PYH38_000282) | 299551..299654 | - | 104 | Protein_281 | TetR/AcrR family transcriptional regulator | - |
| PYH38_RS01415 (PYH38_000283) | 299903..300238 | + | 336 | WP_280731677.1 | RidA family protein | - |
| PYH38_RS01420 (PYH38_000284) | 300551..300765 | - | 215 | Protein_283 | transposase | - |
| PYH38_RS01425 (PYH38_000285) | 301255..301638 | - | 384 | WP_280731678.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PYH38_RS01430 (PYH38_000286) | 301635..301829 | - | 195 | WP_280731679.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PYH38_RS01435 (PYH38_000287) | 302731..303795 | + | 1065 | WP_280731680.1 | class I SAM-dependent methyltransferase | - |
| PYH38_RS01440 (PYH38_000288) | 304191..304604 | - | 414 | WP_280731681.1 | GNAT family N-acetyltransferase | - |
| PYH38_RS01445 (PYH38_000289) | 304760..305785 | - | 1026 | WP_280731682.1 | LacI family DNA-binding transcriptional regulator | - |
| PYH38_RS01450 (PYH38_000290) | 305835..306161 | - | 327 | WP_280731683.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14223.39 Da Isoelectric Point: 6.2148
>T274927 WP_280731678.1 NZ_CP120370:c301638-301255 [Sinorhizobium numidicum]
VRLADTGIWIDHFRLADPQLIQTIENDMLLCHPAIVGELALGSLHNRLVTLGFLAVQREVIIATHDEVMAMIDEHQLYSM
GIGYTDAHLLASTLIDSRAELWTRDKRLRRAAEKARARVVSDGTVPN
VRLADTGIWIDHFRLADPQLIQTIENDMLLCHPAIVGELALGSLHNRLVTLGFLAVQREVIIATHDEVMAMIDEHQLYSM
GIGYTDAHLLASTLIDSRAELWTRDKRLRRAAEKARARVVSDGTVPN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|