Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/NGN_SP-Phd |
| Location | 601164..601825 | Replicon | plasmid unnamed |
| Accession | NZ_CP120369 | ||
| Organism | Sinorhizobium numidicum strain CIP 109850 | ||
Toxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PYH37_RS32005 | Protein ID | WP_280736488.1 |
| Coordinates | 601418..601825 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PYH37_RS32000 | Protein ID | WP_280736490.1 |
| Coordinates | 601164..601418 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH37_RS31965 (PYH37_006392) | 596417..596728 | + | 312 | Protein_560 | ATP-binding protein | - |
| PYH37_RS31970 (PYH37_006393) | 596942..597382 | + | 441 | WP_280663340.1 | DUF2267 domain-containing protein | - |
| PYH37_RS31975 (PYH37_006394) | 597525..597803 | + | 279 | WP_280663341.1 | hypothetical protein | - |
| PYH37_RS31980 (PYH37_006395) | 597925..598386 | - | 462 | WP_280736492.1 | hypothetical protein | - |
| PYH37_RS31985 (PYH37_006396) | 598677..598997 | - | 321 | WP_280736616.1 | DUF1476 domain-containing protein | - |
| PYH37_RS31990 (PYH37_006397) | 599283..599972 | - | 690 | WP_280663344.1 | SMC-Scp complex subunit ScpB | - |
| PYH37_RS31995 (PYH37_006398) | 599975..600928 | - | 954 | WP_280736491.1 | DUF1403 family protein | - |
| PYH37_RS32000 (PYH37_006399) | 601164..601418 | + | 255 | WP_280736490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PYH37_RS32005 (PYH37_006400) | 601418..601825 | + | 408 | WP_280736488.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PYH37_RS32010 (PYH37_006401) | 601948..602937 | + | 990 | WP_280736615.1 | site-specific integrase | - |
| PYH37_RS32015 (PYH37_006402) | 603064..603315 | + | 252 | WP_280736485.1 | hypothetical protein | - |
| PYH37_RS32020 (PYH37_006403) | 603916..604833 | + | 918 | WP_280736484.1 | recombinase family protein | - |
| PYH37_RS32025 (PYH37_006404) | 604940..605137 | + | 198 | WP_280736711.1 | hypothetical protein | - |
| PYH37_RS32030 (PYH37_006405) | 605155..606069 | - | 915 | WP_280736483.1 | nucleotidyltransferase and HEPN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | htpB | 1..629445 | 629445 | |
| - | flank | IS/Tn | - | - | 596417..596740 | 323 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14884.11 Da Isoelectric Point: 6.6458
>T274926 WP_280736488.1 NZ_CP120369:601418-601825 [Sinorhizobium numidicum]
MYLVDTNIVSEARRGAPQAVAWLRSVDPLSIHLSALTLGEIMRGIALKQKSDPKAAAHLAEWLRKLRHDHGDRILPVTDQ
IAVEWGRIAAIRPRGDIDGLLAATAVVHDLILVTRNVKDFEDTDASVINPWETPA
MYLVDTNIVSEARRGAPQAVAWLRSVDPLSIHLSALTLGEIMRGIALKQKSDPKAAAHLAEWLRKLRHDHGDRILPVTDQ
IAVEWGRIAAIRPRGDIDGLLAATAVVHDLILVTRNVKDFEDTDASVINPWETPA
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|