Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 179295..179971 | Replicon | plasmid unnamed |
| Accession | NZ_CP120369 | ||
| Organism | Sinorhizobium numidicum strain CIP 109850 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PYH37_RS29995 | Protein ID | WP_280736330.1 |
| Coordinates | 179295..179717 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A2A6LPC6 |
| Locus tag | PYH37_RS30000 | Protein ID | WP_010875326.1 |
| Coordinates | 179714..179971 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH37_RS29975 (PYH37_005995) | 174472..175311 | - | 840 | WP_280736332.1 | response regulator transcription factor | - |
| PYH37_RS29980 (PYH37_005996) | 176644..176976 | - | 333 | WP_280736331.1 | hypothetical protein | - |
| PYH37_RS29985 (PYH37_005997) | 177401..177589 | + | 189 | Protein_164 | IS30 family transposase | - |
| PYH37_RS29990 (PYH37_005998) | 177705..179077 | + | 1373 | Protein_165 | ISNCY family transposase | - |
| PYH37_RS29995 (PYH37_005999) | 179295..179717 | - | 423 | WP_280736330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PYH37_RS30000 (PYH37_006000) | 179714..179971 | - | 258 | WP_010875326.1 | plasmid stability protein stbC | Antitoxin |
| PYH37_RS30005 (PYH37_006001) | 180290..180586 | + | 297 | WP_280736329.1 | DUF2604 domain-containing protein | - |
| PYH37_RS30010 (PYH37_006002) | 180579..181184 | + | 606 | WP_280736328.1 | hypothetical protein | - |
| PYH37_RS30015 (PYH37_006003) | 181229..181669 | + | 441 | WP_280736327.1 | Mov34/MPN/PAD-1 family protein | - |
| PYH37_RS30020 (PYH37_006004) | 181672..183231 | + | 1560 | WP_280736325.1 | E2 ligase fold family C protein | - |
| PYH37_RS30025 | 183449..183536 | - | 88 | Protein_172 | plasmid stability protein stbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | htpB | 1..629445 | 629445 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15121.44 Da Isoelectric Point: 4.6812
>T274925 WP_280736330.1 NZ_CP120369:c179717-179295 [Sinorhizobium numidicum]
MIVLDTNVISELWKAEPDRTVLAWIDAQMIETLYLSAITVAELRFGLAAMPAGKRRTIFQNRLEGEVLPALAGRVLPFDL
DASRSYADLMAQAKTSGKAIGKADGYIAATAVAHGFMVATRDTSPFEAAGLDIINPWEPA
MIVLDTNVISELWKAEPDRTVLAWIDAQMIETLYLSAITVAELRFGLAAMPAGKRRTIFQNRLEGEVLPALAGRVLPFDL
DASRSYADLMAQAKTSGKAIGKADGYIAATAVAHGFMVATRDTSPFEAAGLDIINPWEPA
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|