Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 2203660..2204300 | Replicon | chromosome |
| Accession | NZ_CP120367 | ||
| Organism | Sinorhizobium numidicum strain CIP 109850 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PYH37_RS10465 | Protein ID | WP_280731348.1 |
| Coordinates | 2203660..2204046 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PYH37_RS10470 | Protein ID | WP_280731349.1 |
| Coordinates | 2204046..2204300 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH37_RS10425 (PYH37_002084) | 2199120..2200037 | - | 918 | WP_280731345.1 | aldo/keto reductase | - |
| PYH37_RS10430 (PYH37_002085) | 2200243..2200347 | - | 105 | Protein_2075 | VOC family protein | - |
| PYH37_RS10435 (PYH37_002086) | 2200368..2200691 | - | 324 | Protein_2076 | integrase | - |
| PYH37_RS10440 (PYH37_002087) | 2200850..2201056 | + | 207 | WP_280732472.1 | cold-shock protein | - |
| PYH37_RS10445 (PYH37_002088) | 2201419..2201784 | + | 366 | WP_280731346.1 | hypothetical protein | - |
| PYH37_RS10450 (PYH37_002089) | 2201773..2202909 | - | 1137 | Protein_2079 | tyrosine-type recombinase/integrase | - |
| PYH37_RS10455 (PYH37_002090) | 2202964..2203239 | - | 276 | WP_280732473.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PYH37_RS10460 (PYH37_002091) | 2203239..2203499 | - | 261 | WP_280731347.1 | ribbon-helix-helix domain-containing protein | - |
| PYH37_RS10465 (PYH37_002092) | 2203660..2204046 | - | 387 | WP_280731348.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PYH37_RS10470 (PYH37_002093) | 2204046..2204300 | - | 255 | WP_280731349.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PYH37_RS10475 (PYH37_002094) | 2204516..2204668 | - | 153 | Protein_2084 | N-acetyltransferase | - |
| PYH37_RS10480 (PYH37_002095) | 2204869..2205138 | + | 270 | WP_280731350.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| PYH37_RS10485 (PYH37_002096) | 2205131..2205391 | + | 261 | WP_280731351.1 | hypothetical protein | - |
| PYH37_RS10490 (PYH37_002097) | 2205915..2206379 | + | 465 | Protein_2087 | hypothetical protein | - |
| PYH37_RS10495 (PYH37_002098) | 2206801..2207040 | + | 240 | WP_280732474.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| PYH37_RS10500 (PYH37_002099) | 2207037..2207366 | + | 330 | WP_280731352.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PYH37_RS10505 (PYH37_002100) | 2207594..2207884 | - | 291 | WP_280731353.1 | DUF1330 domain-containing protein | - |
| PYH37_RS10510 (PYH37_002101) | 2207950..2208435 | + | 486 | WP_280731354.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| PYH37_RS10515 (PYH37_002102) | 2208601..2209291 | - | 691 | Protein_2092 | DUF1868 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13993.89 Da Isoelectric Point: 4.6069
>T274924 WP_280731348.1 NZ_CP120367:c2204046-2203660 [Sinorhizobium numidicum]
MVIDTSAIVAIAFNEPEAESYEQKVVDAPRRFISAATVLELAIVIEARLGEAGAAELDLWLYKAGVEIVAVDAEQIAVAR
RAWRSYGKGRHPAGLNYGDCFSYALAKTRNEPLLFKGDDFSRTDMQAA
MVIDTSAIVAIAFNEPEAESYEQKVVDAPRRFISAATVLELAIVIEARLGEAGAAELDLWLYKAGVEIVAVDAEQIAVAR
RAWRSYGKGRHPAGLNYGDCFSYALAKTRNEPLLFKGDDFSRTDMQAA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|