Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 2202964..2203499 Replicon chromosome
Accession NZ_CP120367
Organism Sinorhizobium numidicum strain CIP 109850

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PYH37_RS10455 Protein ID WP_280732473.1
Coordinates 2202964..2203239 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PYH37_RS10460 Protein ID WP_280731347.1
Coordinates 2203239..2203499 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYH37_RS10420 (PYH37_002083) 2198411..2199085 - 675 WP_280731344.1 DUF6064 family protein -
PYH37_RS10425 (PYH37_002084) 2199120..2200037 - 918 WP_280731345.1 aldo/keto reductase -
PYH37_RS10430 (PYH37_002085) 2200243..2200347 - 105 Protein_2075 VOC family protein -
PYH37_RS10435 (PYH37_002086) 2200368..2200691 - 324 Protein_2076 integrase -
PYH37_RS10440 (PYH37_002087) 2200850..2201056 + 207 WP_280732472.1 cold-shock protein -
PYH37_RS10445 (PYH37_002088) 2201419..2201784 + 366 WP_280731346.1 hypothetical protein -
PYH37_RS10450 (PYH37_002089) 2201773..2202909 - 1137 Protein_2079 tyrosine-type recombinase/integrase -
PYH37_RS10455 (PYH37_002090) 2202964..2203239 - 276 WP_280732473.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PYH37_RS10460 (PYH37_002091) 2203239..2203499 - 261 WP_280731347.1 ribbon-helix-helix domain-containing protein Antitoxin
PYH37_RS10465 (PYH37_002092) 2203660..2204046 - 387 WP_280731348.1 type II toxin-antitoxin system VapC family toxin -
PYH37_RS10470 (PYH37_002093) 2204046..2204300 - 255 WP_280731349.1 type II toxin-antitoxin system VapB family antitoxin -
PYH37_RS10475 (PYH37_002094) 2204516..2204668 - 153 Protein_2084 N-acetyltransferase -
PYH37_RS10480 (PYH37_002095) 2204869..2205138 + 270 WP_280731350.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
PYH37_RS10485 (PYH37_002096) 2205131..2205391 + 261 WP_280731351.1 hypothetical protein -
PYH37_RS10490 (PYH37_002097) 2205915..2206379 + 465 Protein_2087 hypothetical protein -
PYH37_RS10495 (PYH37_002098) 2206801..2207040 + 240 WP_280732474.1 type II toxin-antitoxin system ParD family antitoxin -
PYH37_RS10500 (PYH37_002099) 2207037..2207366 + 330 WP_280731352.1 type II toxin-antitoxin system RelE/ParE family toxin -
PYH37_RS10505 (PYH37_002100) 2207594..2207884 - 291 WP_280731353.1 DUF1330 domain-containing protein -
PYH37_RS10510 (PYH37_002101) 2207950..2208435 + 486 WP_280731354.1 MarR family winged helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(6-43)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10876.46 Da        Isoelectric Point: 9.5559

>T274923 WP_280732473.1 NZ_CP120367:c2203239-2202964 [Sinorhizobium numidicum]
MKLEWSSKAVSDLGRLYDFLALVNRQAAVRTVQSLTSAPTSLLEQPWIGERLEEFNPREVRRIVVGHYEMRYEIRQSTIY
VLRLWHTREER

Download         Length: 276 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9725.08 Da        Isoelectric Point: 5.1239

>AT274923 WP_280731347.1 NZ_CP120367:c2203499-2203239 [Sinorhizobium numidicum]
METKVVTAHVPLPLAEKVDQIAARLERSRGWIVKQALAAWIDQEEERRRMTLEALADVDSGRVIDHQSVQAWADSLDSDK
PRPLPL

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References