Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 584749..585410 | Replicon | chromosome |
| Accession | NZ_CP120367 | ||
| Organism | Sinorhizobium numidicum strain CIP 109850 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PYH37_RS02865 | Protein ID | WP_280731929.1 |
| Coordinates | 584749..585186 (-) | Length | 146 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PYH37_RS02870 | Protein ID | WP_280731930.1 |
| Coordinates | 585183..585410 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH37_RS02845 (PYH37_000568) | 580893..581054 | + | 162 | WP_280731926.1 | hypothetical protein | - |
| PYH37_RS02850 (PYH37_000569) | 581515..582660 | + | 1146 | Protein_569 | Fic family protein | - |
| PYH37_RS02855 (PYH37_000570) | 582611..583564 | - | 954 | WP_280731927.1 | IS481 family transposase | - |
| PYH37_RS02860 (PYH37_000571) | 583934..584584 | + | 651 | WP_280731928.1 | glutathione S-transferase family protein | - |
| PYH37_RS02865 (PYH37_000572) | 584749..585186 | - | 438 | WP_280731929.1 | PIN domain-containing protein | Toxin |
| PYH37_RS02870 (PYH37_000573) | 585183..585410 | - | 228 | WP_280731930.1 | CopG family transcriptional regulator | Antitoxin |
| PYH37_RS02875 (PYH37_000574) | 585996..586625 | + | 630 | WP_280731931.1 | response regulator transcription factor | - |
| PYH37_RS02880 (PYH37_000575) | 586804..587994 | + | 1191 | WP_280731932.1 | aminotransferase class V-fold PLP-dependent enzyme | - |
| PYH37_RS02885 (PYH37_000576) | 588017..588961 | + | 945 | WP_280731933.1 | CoA ester lyase | - |
| PYH37_RS02890 (PYH37_000577) | 588974..590158 | + | 1185 | WP_280731935.1 | malate--CoA ligase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 582611..583564 | 953 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15244.48 Da Isoelectric Point: 6.9661
>T274922 WP_280731929.1 NZ_CP120367:c585186-584749 [Sinorhizobium numidicum]
VTFLLDVNVLIALIDPGHVAHDDAHDWFASIGQTAWATCPITENGVIRIVGNAKYPNSPGSPSLVMEIVGKLRSLPGHCF
WPDDVSLVGSGDIAATKILTSGQVTDTYLLALAKAHGGQLATFDRKLSAAAVTRGNAALRLITSK
VTFLLDVNVLIALIDPGHVAHDDAHDWFASIGQTAWATCPITENGVIRIVGNAKYPNSPGSPSLVMEIVGKLRSLPGHCF
WPDDVSLVGSGDIAATKILTSGQVTDTYLLALAKAHGGQLATFDRKLSAAAVTRGNAALRLITSK
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|