Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 299235..299809 | Replicon | chromosome |
Accession | NZ_CP120367 | ||
Organism | Sinorhizobium numidicum strain CIP 109850 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PYH37_RS01415 | Protein ID | WP_280731678.1 |
Coordinates | 299235..299618 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PYH37_RS01420 | Protein ID | WP_280731679.1 |
Coordinates | 299615..299809 (-) | Length | 65 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYH37_RS01390 (PYH37_000278) | 294709..295965 | + | 1257 | WP_280731674.1 | ribulose-bisphosphate carboxylase large subunit family protein | - |
PYH37_RS01395 (PYH37_000279) | 295999..297333 | + | 1335 | WP_280731676.1 | four-carbon acid sugar kinase family protein | - |
PYH37_RS01400 (PYH37_000280) | 297531..297634 | - | 104 | Protein_279 | TetR/AcrR family transcriptional regulator | - |
PYH37_RS01405 (PYH37_000281) | 297883..298218 | + | 336 | WP_280731677.1 | RidA family protein | - |
PYH37_RS01410 (PYH37_000282) | 298531..298745 | - | 215 | Protein_281 | transposase | - |
PYH37_RS01415 (PYH37_000283) | 299235..299618 | - | 384 | WP_280731678.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PYH37_RS01420 (PYH37_000284) | 299615..299809 | - | 195 | WP_280731679.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PYH37_RS01425 (PYH37_000285) | 300711..301775 | + | 1065 | WP_280731680.1 | class I SAM-dependent methyltransferase | - |
PYH37_RS01430 (PYH37_000286) | 302171..302584 | - | 414 | WP_280731681.1 | GNAT family N-acetyltransferase | - |
PYH37_RS01435 (PYH37_000287) | 302740..303765 | - | 1026 | WP_280731682.1 | LacI family DNA-binding transcriptional regulator | - |
PYH37_RS01440 (PYH37_000288) | 303815..304141 | - | 327 | WP_280731683.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14223.39 Da Isoelectric Point: 6.2148
>T274921 WP_280731678.1 NZ_CP120367:c299618-299235 [Sinorhizobium numidicum]
VRLADTGIWIDHFRLADPQLIQTIENDMLLCHPAIVGELALGSLHNRLVTLGFLAVQREVIIATHDEVMAMIDEHQLYSM
GIGYTDAHLLASTLIDSRAELWTRDKRLRRAAEKARARVVSDGTVPN
VRLADTGIWIDHFRLADPQLIQTIENDMLLCHPAIVGELALGSLHNRLVTLGFLAVQREVIIATHDEVMAMIDEHQLYSM
GIGYTDAHLLASTLIDSRAELWTRDKRLRRAAEKARARVVSDGTVPN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|