Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 965995..966593 | Replicon | plasmid pSkuCCBAU71714a |
| Accession | NZ_CP120366 | ||
| Organism | Sinorhizobium kummerowiae strain CCBAU 71714 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q930F0 |
| Locus tag | PZL22_RS29195 | Protein ID | WP_010967243.1 |
| Coordinates | 966300..966593 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q930F1 |
| Locus tag | PZL22_RS29190 | Protein ID | WP_010967242.1 |
| Coordinates | 965995..966303 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZL22_RS29170 (PZL22_005837) | 962025..962972 | - | 948 | WP_127668391.1 | substrate-binding domain-containing protein | - |
| PZL22_RS29175 (PZL22_005838) | 963047..963358 | - | 312 | WP_127634532.1 | MocE family 2Fe-2S type ferredoxin | - |
| PZL22_RS29180 (PZL22_005839) | 963355..964389 | - | 1035 | WP_127701581.1 | sterol desaturase family protein | - |
| PZL22_RS29185 (PZL22_005840) | 964569..965570 | - | 1002 | WP_041170005.1 | LacI family DNA-binding transcriptional regulator | - |
| PZL22_RS29190 (PZL22_005841) | 965995..966303 | + | 309 | WP_010967242.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PZL22_RS29195 (PZL22_005842) | 966300..966593 | + | 294 | WP_010967243.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| PZL22_RS29200 (PZL22_005843) | 966730..967676 | + | 947 | WP_088895623.1 | IS630-like element ISRm2011-2 family transposase | - |
| PZL22_RS29205 (PZL22_005844) | 967886..969220 | - | 1335 | WP_284718729.1 | ISNCY-like element ISRm17 family transposase | - |
| PZL22_RS29210 (PZL22_005845) | 969586..970785 | - | 1200 | WP_028005114.1 | NAD-dependent formate dehydrogenase | - |
| PZL22_RS29215 (PZL22_005846) | 971200..971265 | + | 66 | Protein_969 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | htpB / htpB | 1..1418903 | 1418903 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11278.93 Da Isoelectric Point: 6.4734
>T274920 WP_010967243.1 NZ_CP120366:966300-966593 [Sinorhizobium kummerowiae]
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|