Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 932358..932938 | Replicon | plasmid pSkuCCBAU71714a |
Accession | NZ_CP120366 | ||
Organism | Sinorhizobium kummerowiae strain CCBAU 71714 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q92XP1 |
Locus tag | PZL22_RS29025 | Protein ID | WP_010968151.1 |
Coordinates | 932358..932741 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | F7XCL0 |
Locus tag | PZL22_RS29030 | Protein ID | WP_013851145.1 |
Coordinates | 932738..932938 (-) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PZL22_RS29000 (PZL22_005802) | 928407..929048 | - | 642 | WP_234836496.1 | DUF433 domain-containing protein | - |
PZL22_RS29005 (PZL22_005803) | 929304..929651 | - | 348 | WP_234708636.1 | TIGR02588 family protein | - |
PZL22_RS29010 (PZL22_005804) | 929747..930583 | - | 837 | WP_127535252.1 | TIGR02587 family membrane protein | - |
PZL22_RS29015 (PZL22_005805) | 930916..931227 | + | 312 | WP_164843122.1 | hypothetical protein | - |
PZL22_RS29020 (PZL22_005806) | 931514..931900 | - | 387 | WP_234708651.1 | response regulator | - |
PZL22_RS29025 (PZL22_005807) | 932358..932741 | - | 384 | WP_010968151.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PZL22_RS29030 (PZL22_005808) | 932738..932938 | - | 201 | WP_013851145.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PZL22_RS29035 (PZL22_005809) | 935188..936666 | - | 1479 | WP_284718730.1 | calcium-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | htpB / htpB | 1..1418903 | 1418903 | |
- | flank | IS/Tn | - | - | 927012..928346 | 1334 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14292.54 Da Isoelectric Point: 6.9172
>T274919 WP_010968151.1 NZ_CP120366:c932741-932358 [Sinorhizobium kummerowiae]
VILADTSIWIDHFRHTDAELRRIIEDDRLLCHPAVIGELALGSLRERSSVIAFLMAQREALVATHQEVMMMIDRHAIFSM
GIGYTDAHLLASVLLDQRMALWTRDKRLQAAAEKAGASLHTPAHTRN
VILADTSIWIDHFRHTDAELRRIIEDDRLLCHPAVIGELALGSLRERSSVIAFLMAQREALVATHQEVMMMIDRHAIFSM
GIGYTDAHLLASVLLDQRMALWTRDKRLQAAAEKAGASLHTPAHTRN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q92XP1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W6MID2 |