Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3396..4081 | Replicon | plasmid pSkuCCBAU71714a |
| Accession | NZ_CP120366 | ||
| Organism | Sinorhizobium kummerowiae strain CCBAU 71714 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PZL22_RS24375 | Protein ID | WP_088198215.1 |
| Coordinates | 3396..3815 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PZL22_RS24380 | Protein ID | WP_088196198.1 |
| Coordinates | 3812..4081 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZL22_RS24365 (PZL22_004877) | 1..2172 | + | 2172 | WP_127634375.1 | molybdopterin-dependent oxidoreductase | - |
| PZL22_RS24370 (PZL22_004878) | 2909..3067 | + | 159 | WP_164820653.1 | hypothetical protein | - |
| PZL22_RS24375 (PZL22_004879) | 3396..3815 | - | 420 | WP_088198215.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PZL22_RS24380 (PZL22_004880) | 3812..4081 | - | 270 | WP_088196198.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PZL22_RS24385 (PZL22_004881) | 4212..4678 | + | 467 | Protein_4 | LysR substrate-binding domain-containing protein | - |
| PZL22_RS24390 (PZL22_004882) | 4769..5644 | - | 876 | WP_164820652.1 | LysR family transcriptional regulator | - |
| PZL22_RS24400 (PZL22_004884) | 7162..7371 | + | 210 | WP_234837684.1 | hypothetical protein | - |
| PZL22_RS24405 (PZL22_004885) | 7428..7808 | - | 381 | WP_127525420.1 | transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | htpB / htpB | 1..1418903 | 1418903 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14837.05 Da Isoelectric Point: 4.5732
>T274916 WP_088198215.1 NZ_CP120366:c3815-3396 [Sinorhizobium kummerowiae]
VSRLYMLDTDIVSELARNPQGAVTKRIAEVGPDAICVSIITAAELRYGCAKKGSSKLLAQIETILESMQVLALDVPADAE
YGGIRAELEAAGRPIGPNDLFIAAHACMLGAVLVTANSSEFTRIRDLKVENWLDFTSSG
VSRLYMLDTDIVSELARNPQGAVTKRIAEVGPDAICVSIITAAELRYGCAKKGSSKLLAQIETILESMQVLALDVPADAE
YGGIRAELEAAGRPIGPNDLFIAAHACMLGAVLVTANSSEFTRIRDLKVENWLDFTSSG
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|