Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 3307659..3308276 | Replicon | chromosome |
| Accession | NZ_CP120365 | ||
| Organism | Sinorhizobium kummerowiae strain CCBAU 71714 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | H0G9X2 |
| Locus tag | PZL22_RS22770 | Protein ID | WP_003536280.1 |
| Coordinates | 3308025..3308276 (-) | Length | 84 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PZL22_RS22765 | Protein ID | WP_003536282.1 |
| Coordinates | 3307659..3308015 (-) | Length | 119 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZL22_RS22740 (PZL22_004552) | 3303054..3303650 | + | 597 | WP_234835738.1 | hypothetical protein | - |
| PZL22_RS22745 (PZL22_004553) | 3303801..3306419 | + | 2619 | WP_003536287.1 | mechanosensitive ion channel family protein | - |
| PZL22_RS22750 (PZL22_004554) | 3306503..3306916 | - | 414 | WP_003536285.1 | hypothetical protein | - |
| PZL22_RS22760 (PZL22_004556) | 3307510..3307653 | + | 144 | WP_010968935.1 | hypothetical protein | - |
| PZL22_RS22765 (PZL22_004557) | 3307659..3308015 | - | 357 | WP_003536282.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PZL22_RS22770 (PZL22_004558) | 3308025..3308276 | - | 252 | WP_003536280.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PZL22_RS22775 (PZL22_004559) | 3308466..3309962 | - | 1497 | WP_003536275.1 | sulfate adenylyltransferase subunit CysN | - |
| PZL22_RS22780 (PZL22_004560) | 3309962..3310915 | - | 954 | WP_003536273.1 | sulfate adenylyltransferase subunit CysD | - |
| PZL22_RS22785 (PZL22_004561) | 3310963..3311760 | - | 798 | WP_003536270.1 | phosphoadenylyl-sulfate reductase | - |
| PZL22_RS22790 (PZL22_004562) | 3312040..3312426 | + | 387 | WP_003536268.1 | DUF6152 family protein | - |
| PZL22_RS22795 (PZL22_004563) | 3312426..3312905 | + | 480 | WP_003536266.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 9277.85 Da Isoelectric Point: 10.6576
>T274914 WP_003536280.1 NZ_CP120365:c3308276-3308025 [Sinorhizobium kummerowiae]
MKKVVYSKSSVKLLRRLAANDAKRIVSKVEQYASDPKSLGNNVKPLTGSPYIRLRVGDWRVIMDDQGVVLDIIKIGSRGS
VYE
MKKVVYSKSSVKLLRRLAANDAKRIVSKVEQYASDPKSLGNNVKPLTGSPYIRLRVGDWRVIMDDQGVVLDIIKIGSRGS
VYE
Download Length: 252 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 12719.57 Da Isoelectric Point: 4.7719
>AT274914 WP_003536282.1 NZ_CP120365:c3308015-3307659 [Sinorhizobium kummerowiae]
MQTITTPGGETLVVLPIAEYEDLLDRADIAQADKVKADIAAGRDELVPAEVVNRLLAGENAVKVWRSRRGMAARELAKKA
RISAPYLSEIESGKKDGSLSTMKKIAEALSVDLDDLAQ
MQTITTPGGETLVVLPIAEYEDLLDRADIAQADKVKADIAAGRDELVPAEVVNRLLAGENAVKVWRSRRGMAARELAKKA
RISAPYLSEIESGKKDGSLSTMKKIAEALSVDLDDLAQ
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|