Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 3154765..3155405 | Replicon | chromosome |
| Accession | NZ_CP120365 | ||
| Organism | Sinorhizobium kummerowiae strain CCBAU 71714 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | H0G6N1 |
| Locus tag | PZL22_RS22050 | Protein ID | WP_003533691.1 |
| Coordinates | 3154765..3155151 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | H0G6N0 |
| Locus tag | PZL22_RS22055 | Protein ID | WP_003533689.1 |
| Coordinates | 3155151..3155405 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZL22_RS22025 (PZL22_004409) | 3150231..3150710 | + | 480 | WP_003537307.1 | GNAT family N-acetyltransferase | - |
| PZL22_RS22030 (PZL22_004410) | 3150753..3151202 | - | 450 | WP_003537305.1 | nucleoside deaminase | - |
| PZL22_RS22035 (PZL22_004411) | 3151277..3152998 | + | 1722 | WP_127517016.1 | pseudouridine synthase | - |
| PZL22_RS22040 (PZL22_004412) | 3153005..3153565 | + | 561 | WP_003533694.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| PZL22_RS22045 (PZL22_004413) | 3153638..3154537 | + | 900 | WP_003533692.1 | patatin-like phospholipase family protein | - |
| PZL22_RS22050 (PZL22_004414) | 3154765..3155151 | - | 387 | WP_003533691.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PZL22_RS22055 (PZL22_004415) | 3155151..3155405 | - | 255 | WP_003533689.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PZL22_RS22060 (PZL22_004416) | 3155544..3157376 | - | 1833 | WP_003533687.1 | monovalent cation:proton antiporter-2 (CPA2) family protein | - |
| PZL22_RS22065 (PZL22_004417) | 3157528..3158874 | + | 1347 | WP_284718564.1 | TldD/PmbA family protein | - |
| PZL22_RS22070 (PZL22_004418) | 3158919..3159737 | + | 819 | WP_003533685.1 | 3'(2'),5'-bisphosphate nucleotidase CysQ | - |
| PZL22_RS22075 (PZL22_004419) | 3159798..3160034 | + | 237 | WP_003533684.1 | DUF4170 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13904.77 Da Isoelectric Point: 4.5716
>T274913 WP_003533691.1 NZ_CP120365:c3155151-3154765 [Sinorhizobium kummerowiae]
MVIDTSAIAAIAFNEQEAGSFREKIADDPVRLISAATALEAAMVIETRLGEAAGAELDLWLYKANVEIVAVTAEHMDQAR
RAWRRFGKGRHPAGLNFGDCFSYALAFLTNEPLLFKGSDFSQTDIPAA
MVIDTSAIAAIAFNEQEAGSFREKIADDPVRLISAATALEAAMVIETRLGEAAGAELDLWLYKANVEIVAVTAEHMDQAR
RAWRRFGKGRHPAGLNFGDCFSYALAFLTNEPLLFKGSDFSQTDIPAA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|