Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2268573..2269234 | Replicon | chromosome |
Accession | NZ_CP120365 | ||
Organism | Sinorhizobium kummerowiae strain CCBAU 71714 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | H0G400 |
Locus tag | PZL22_RS17895 | Protein ID | WP_003531794.1 |
Coordinates | 2268573..2268977 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | H0G3Z9 |
Locus tag | PZL22_RS17900 | Protein ID | WP_003531793.1 |
Coordinates | 2268974..2269234 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PZL22_RS17880 (PZL22_003580) | 2264145..2265257 | + | 1113 | WP_003535893.1 | 3-isopropylmalate dehydrogenase | - |
PZL22_RS17885 (PZL22_003581) | 2265386..2266093 | + | 708 | WP_003535894.1 | phosphatase PAP2 family protein | - |
PZL22_RS17890 (PZL22_003582) | 2266194..2268083 | - | 1890 | WP_003535895.1 | MFS transporter | - |
PZL22_RS17895 (PZL22_003583) | 2268573..2268977 | - | 405 | WP_003531794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PZL22_RS17900 (PZL22_003584) | 2268974..2269234 | - | 261 | WP_003531793.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PZL22_RS17905 (PZL22_003585) | 2269647..2270681 | + | 1035 | WP_003531790.1 | aspartate-semialdehyde dehydrogenase | - |
PZL22_RS17910 (PZL22_003586) | 2270854..2271675 | + | 822 | WP_003531785.1 | lytic transglycosylase domain-containing protein | - |
PZL22_RS17915 (PZL22_003587) | 2272022..2272705 | - | 684 | WP_010970569.1 | carbonic anhydrase | - |
PZL22_RS17920 (PZL22_003588) | 2272879..2273760 | - | 882 | WP_003531772.1 | pyridoxal kinase PdxY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14480.69 Da Isoelectric Point: 6.7257
>T274911 WP_003531794.1 NZ_CP120365:c2268977-2268573 [Sinorhizobium kummerowiae]
VISHILDTSAVIALIGRKSDALVTRVLHSPQGIIGLPSVVAYELYFGAQKSAKAQHNLETLRLLMADFPILDFDRNDAFV
AGEIRAALAAKGTPIGPYDVLIAGQAKARGLTLVTNNVGEFNRVENLRVEDWSL
VISHILDTSAVIALIGRKSDALVTRVLHSPQGIIGLPSVVAYELYFGAQKSAKAQHNLETLRLLMADFPILDFDRNDAFV
AGEIRAALAAKGTPIGPYDVLIAGQAKARGLTLVTNNVGEFNRVENLRVEDWSL
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|