Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1607300..1607931 | Replicon | chromosome |
| Accession | NZ_CP120365 | ||
| Organism | Sinorhizobium kummerowiae strain CCBAU 71714 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PZL22_RS14920 | Protein ID | WP_003527486.1 |
| Coordinates | 1607300..1607698 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | H0FX30 |
| Locus tag | PZL22_RS14925 | Protein ID | WP_003527488.1 |
| Coordinates | 1607698..1607931 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZL22_RS14885 (PZL22_002981) | 1602382..1602684 | - | 303 | WP_003527462.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PZL22_RS14890 (PZL22_002982) | 1602681..1602956 | - | 276 | WP_003527463.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| PZL22_RS14895 (PZL22_002983) | 1603242..1603391 | + | 150 | WP_003527468.1 | hypothetical protein | - |
| PZL22_RS14900 (PZL22_002984) | 1603388..1604323 | + | 936 | WP_003527477.1 | site-specific tyrosine recombinase XerD | - |
| PZL22_RS14905 (PZL22_002985) | 1604387..1605340 | + | 954 | WP_003527479.1 | acetyl-CoA carboxylase carboxyltransferase subunit alpha | - |
| PZL22_RS14910 (PZL22_002986) | 1605585..1607027 | + | 1443 | WP_003527482.1 | murein L,D-transpeptidase family protein | - |
| PZL22_RS14915 (PZL22_002987) | 1607027..1607266 | + | 240 | WP_033048505.1 | sulfurtransferase TusA family protein | - |
| PZL22_RS14920 (PZL22_002988) | 1607300..1607698 | - | 399 | WP_003527486.1 | type II toxin-antitoxin system toxin VapC | Toxin |
| PZL22_RS14925 (PZL22_002989) | 1607698..1607931 | - | 234 | WP_003527488.1 | type II toxin-antitoxin system antitoxin VapB | Antitoxin |
| PZL22_RS14930 (PZL22_002990) | 1608040..1609185 | - | 1146 | WP_003527490.1 | GTP-binding protein | - |
| PZL22_RS14935 (PZL22_002991) | 1609199..1610281 | - | 1083 | WP_003527492.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| PZL22_RS14940 (PZL22_002992) | 1610533..1611696 | + | 1164 | WP_003527494.1 | M20 aminoacylase family protein | - |
| PZL22_RS14945 (PZL22_002993) | 1611719..1612183 | + | 465 | WP_010970133.1 | Lrp/AsnC ligand binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14857.18 Da Isoelectric Point: 6.9581
>T274910 WP_003527486.1 NZ_CP120365:c1607698-1607300 [Sinorhizobium kummerowiae]
MLTYMLDTNICIYVMKTYPPVVREKFNGLAEQLCISSITLGELHYGAEKSARRVENLTAIEHFVARLEVLPFADKAAAHY
GQVRAELERTGTPCGPHDMQIGAHARSEGLIVVTNNIREFVRMPGVRVENWL
MLTYMLDTNICIYVMKTYPPVVREKFNGLAEQLCISSITLGELHYGAEKSARRVENLTAIEHFVARLEVLPFADKAAAHY
GQVRAELERTGTPCGPHDMQIGAHARSEGLIVVTNNIREFVRMPGVRVENWL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|