Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 1607300..1607931 Replicon chromosome
Accession NZ_CP120365
Organism Sinorhizobium kummerowiae strain CCBAU 71714

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PZL22_RS14920 Protein ID WP_003527486.1
Coordinates 1607300..1607698 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID H0FX30
Locus tag PZL22_RS14925 Protein ID WP_003527488.1
Coordinates 1607698..1607931 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PZL22_RS14885 (PZL22_002981) 1602382..1602684 - 303 WP_003527462.1 type II toxin-antitoxin system RelE/ParE family toxin -
PZL22_RS14890 (PZL22_002982) 1602681..1602956 - 276 WP_003527463.1 type II toxin-antitoxin system ParD family antitoxin -
PZL22_RS14895 (PZL22_002983) 1603242..1603391 + 150 WP_003527468.1 hypothetical protein -
PZL22_RS14900 (PZL22_002984) 1603388..1604323 + 936 WP_003527477.1 site-specific tyrosine recombinase XerD -
PZL22_RS14905 (PZL22_002985) 1604387..1605340 + 954 WP_003527479.1 acetyl-CoA carboxylase carboxyltransferase subunit alpha -
PZL22_RS14910 (PZL22_002986) 1605585..1607027 + 1443 WP_003527482.1 murein L,D-transpeptidase family protein -
PZL22_RS14915 (PZL22_002987) 1607027..1607266 + 240 WP_033048505.1 sulfurtransferase TusA family protein -
PZL22_RS14920 (PZL22_002988) 1607300..1607698 - 399 WP_003527486.1 type II toxin-antitoxin system toxin VapC Toxin
PZL22_RS14925 (PZL22_002989) 1607698..1607931 - 234 WP_003527488.1 type II toxin-antitoxin system antitoxin VapB Antitoxin
PZL22_RS14930 (PZL22_002990) 1608040..1609185 - 1146 WP_003527490.1 GTP-binding protein -
PZL22_RS14935 (PZL22_002991) 1609199..1610281 - 1083 WP_003527492.1 D-alanyl-D-alanine carboxypeptidase family protein -
PZL22_RS14940 (PZL22_002992) 1610533..1611696 + 1164 WP_003527494.1 M20 aminoacylase family protein -
PZL22_RS14945 (PZL22_002993) 1611719..1612183 + 465 WP_010970133.1 Lrp/AsnC ligand binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-123)

Antitoxin

SpoVT-AbrB domain

(7-56)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14857.18 Da        Isoelectric Point: 6.9581

>T274910 WP_003527486.1 NZ_CP120365:c1607698-1607300 [Sinorhizobium kummerowiae]
MLTYMLDTNICIYVMKTYPPVVREKFNGLAEQLCISSITLGELHYGAEKSARRVENLTAIEHFVARLEVLPFADKAAAHY
GQVRAELERTGTPCGPHDMQIGAHARSEGLIVVTNNIREFVRMPGVRVENWL

Download         Length: 399 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8687.90 Da        Isoelectric Point: 8.9167

>AT274910 WP_003527488.1 NZ_CP120365:c1607931-1607698 [Sinorhizobium kummerowiae]
MASSTVFISNRSQAVRLPKAVAFPEGVHQVDILKIGRSRVIVPQGKRWDDLFLSGPRVSEDFMSEREQPVAETRESF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB H0FX30

References