Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
| Location | 1559935..1560701 | Replicon | chromosome |
| Accession | NZ_CP120365 | ||
| Organism | Sinorhizobium kummerowiae strain CCBAU 71714 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | H0G6D3 |
| Locus tag | PZL22_RS14650 | Protein ID | WP_003533488.1 |
| Coordinates | 1560219..1560701 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | H0G6D4 |
| Locus tag | PZL22_RS14645 | Protein ID | WP_003533490.1 |
| Coordinates | 1559935..1560219 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZL22_RS14630 (PZL22_002930) | 1555405..1556793 | + | 1389 | WP_003533497.1 | lipopolysaccharide biosynthesis protein | - |
| PZL22_RS14635 (PZL22_002931) | 1556797..1558068 | + | 1272 | WP_003533495.1 | GNAT family N-acetyltransferase | - |
| PZL22_RS14640 (PZL22_002932) | 1558084..1559730 | - | 1647 | WP_003533493.1 | AMP-binding protein | - |
| PZL22_RS14645 (PZL22_002933) | 1559935..1560219 | + | 285 | WP_003533490.1 | DUF1778 domain-containing protein | Antitoxin |
| PZL22_RS14650 (PZL22_002934) | 1560219..1560701 | + | 483 | WP_003533488.1 | GNAT family N-acetyltransferase | Toxin |
| PZL22_RS14660 (PZL22_002936) | 1561166..1561675 | + | 510 | WP_003533487.1 | disulfide bond formation protein B | - |
| PZL22_RS14665 (PZL22_002937) | 1561707..1562264 | - | 558 | WP_003533486.1 | HNH endonuclease | - |
| PZL22_RS14670 (PZL22_002938) | 1562370..1563017 | - | 648 | WP_003533485.1 | DNA-3-methyladenine glycosylase | - |
| PZL22_RS14675 (PZL22_002939) | 1563170..1564066 | + | 897 | WP_003533484.1 | tRNA glutamyl-Q(34) synthetase GluQRS | - |
| PZL22_RS14680 (PZL22_002940) | 1564085..1564960 | - | 876 | WP_010970093.1 | YihY/virulence factor BrkB family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17463.88 Da Isoelectric Point: 7.3827
>T274909 WP_003533488.1 NZ_CP120365:1560219-1560701 [Sinorhizobium kummerowiae]
MLSAPTPLGEAHDFDLFQSGNDTLDDWLRRRAHANQASGASRTYVIAEEWRVVGYYCLASGALDLADAPSSVRRNMPDPI
PMAVLGRLAIDRDWQGKGLGAALLQDAVLRSSQAADIMGIRGLLVHAISGEAKAFYEHYGFQCSPNHPMTLVLSLKGKRR
MLSAPTPLGEAHDFDLFQSGNDTLDDWLRRRAHANQASGASRTYVIAEEWRVVGYYCLASGALDLADAPSSVRRNMPDPI
PMAVLGRLAIDRDWQGKGLGAALLQDAVLRSSQAADIMGIRGLLVHAISGEAKAFYEHYGFQCSPNHPMTLVLSLKGKRR
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|