Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-VagC
Location 1369930..1370603 Replicon chromosome
Accession NZ_CP120365
Organism Sinorhizobium kummerowiae strain CCBAU 71714

Toxin (Protein)


Gene name vapC Uniprot ID H0GA11
Locus tag PZL22_RS13730 Protein ID WP_003536347.1
Coordinates 1370199..1370603 (+) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID H0GA10
Locus tag PZL22_RS13725 Protein ID WP_003536345.1
Coordinates 1369930..1370202 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PZL22_RS13705 (PZL22_002745) 1365921..1367561 - 1641 WP_003536336.1 ABC transporter substrate-binding protein -
PZL22_RS13710 (PZL22_002746) 1367609..1368664 - 1056 WP_003536337.1 dipeptidase -
PZL22_RS13715 (PZL22_002747) 1368844..1369185 - 342 WP_003536339.1 SMR family transporter -
PZL22_RS13720 (PZL22_002748) 1369233..1369793 - 561 WP_003536341.1 TetR/AcrR family transcriptional regulator -
PZL22_RS13725 (PZL22_002749) 1369930..1370202 + 273 WP_003536345.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
PZL22_RS13730 (PZL22_002750) 1370199..1370603 + 405 WP_003536347.1 type II toxin-antitoxin system VapC family toxin Toxin
PZL22_RS13735 (PZL22_002751) 1370731..1371123 + 393 WP_003536349.1 globin -
PZL22_RS13740 (PZL22_002752) 1371129..1371503 + 375 WP_003536350.1 DUF423 domain-containing protein -
PZL22_RS13745 (PZL22_002753) 1371626..1371874 + 249 WP_003536352.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
PZL22_RS13750 (PZL22_002754) 1372090..1372404 - 315 WP_003536354.1 antibiotic biosynthesis monooxygenase -
PZL22_RS13755 (PZL22_002755) 1372417..1372683 - 267 WP_003536356.1 hypothetical protein -
PZL22_RS13760 (PZL22_002756) 1372736..1373149 - 414 WP_003536357.1 DUF2325 domain-containing protein -
PZL22_RS13765 (PZL22_002757) 1373357..1374283 - 927 WP_010969930.1 energy transducer TonB -
PZL22_RS13770 (PZL22_002758) 1374324..1374758 - 435 WP_003536361.1 hypothetical protein -
PZL22_RS13775 (PZL22_002759) 1374988..1375128 + 141 WP_003536363.1 hemin uptake protein HemP -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(16-54)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 14778.01 Da        Isoelectric Point: 5.1974

>T274908 WP_003536347.1 NZ_CP120365:1370199-1370603 [Sinorhizobium kummerowiae]
MNGYLLDTNIISDVIHNPFGPAAQRIERIGPKEIYTSIVVASELRYGCAKKGSAKLLAKVESLLEIVPVLPLDIPADTRY
GSIRAELESLGQTISSNDLLIAAHAYALDLTLVTDNIREFSRVRGLSLENWLER

Download         Length: 405 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10334.02 Da        Isoelectric Point: 6.3950

>AT274908 WP_003536345.1 NZ_CP120365:1369930-1370202 [Sinorhizobium kummerowiae]
MPVPLPSSRPKEVKLFRNNRSQAVRIPAEFELPGDRVLIRREGTRLIIEPIARPADIVELLAEWKKEAPLGPEDRFPDVE
DIPARPEKIF

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H0GA11

Antitoxin

Source ID Structure
AlphaFold DB H0GA10

References