Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 1256808..1257279 Replicon chromosome
Accession NZ_CP120365
Organism Sinorhizobium kummerowiae strain CCBAU 71714

Toxin (Protein)


Gene name - Uniprot ID H0GBE3
Locus tag PZL22_RS13160 Protein ID WP_003537553.1
Coordinates 1257016..1257279 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID H0GBE4
Locus tag PZL22_RS13155 Protein ID WP_003537555.1
Coordinates 1256808..1257029 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PZL22_RS13125 (PZL22_002629) 1252127..1252756 + 630 WP_127517673.1 hypothetical protein -
PZL22_RS13130 (PZL22_002630) 1252872..1253237 + 366 WP_234841763.1 ribonuclease E inhibitor RraB -
PZL22_RS13135 (PZL22_002631) 1253365..1253703 + 339 WP_003534165.1 hypothetical protein -
PZL22_RS13140 (PZL22_002632) 1253723..1254484 - 762 WP_003534163.1 Stf0 family sulphotransferase -
PZL22_RS13145 (PZL22_002633) 1254621..1255711 - 1091 Protein_1194 IS630 family transposase -
PZL22_RS13150 (PZL22_002634) 1255863..1256489 - 627 WP_003537557.1 hypothetical protein -
PZL22_RS13155 (PZL22_002635) 1256808..1257029 - 222 WP_003537555.1 hypothetical protein Antitoxin
PZL22_RS13160 (PZL22_002636) 1257016..1257279 - 264 WP_003537553.1 BrnT family toxin Toxin
PZL22_RS13170 (PZL22_002638) 1257880..1258668 + 789 WP_003537551.1 SIMPL domain-containing protein -
PZL22_RS13175 (PZL22_002639) 1258755..1259111 - 357 WP_003537549.1 hypothetical protein -
PZL22_RS13180 (PZL22_002640) 1259368..1259772 - 405 WP_003537547.1 nuclear transport factor 2 family protein -
PZL22_RS13185 (PZL22_002641) 1259881..1260303 - 423 WP_003537545.1 secondary thiamine-phosphate synthase enzyme YjbQ -
PZL22_RS13190 (PZL22_002642) 1260416..1260769 - 354 WP_003537534.1 DUF1428 domain-containing protein -
PZL22_RS13195 (PZL22_002643) 1260871..1261440 - 570 WP_003537532.1 transglycosylase SLT domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1254621..1255508 887
- flank IS/Tn - - 1261584..1262780 1196


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(5-80)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10244.50 Da        Isoelectric Point: 6.7291

>T274907 WP_003537553.1 NZ_CP120365:c1257279-1257016 [Sinorhizobium kummerowiae]
MDYEFDPAKSASNHEKHGIDFEAAQELWRDERLLEVLAKTEDEPRFLAIGKIGGKHWTAVFTYRGSVRRIISVRRARKQE
TEYYESL

Download         Length: 264 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8364.45 Da        Isoelectric Point: 5.0900

>AT274907 WP_003537555.1 NZ_CP120365:c1257029-1256808 [Sinorhizobium kummerowiae]
MKASEFDKRFDAGEDIDAEIDWGKAQRPNLEVRRVNVDFPAWVVDGLDRESQRLGITRQALIKVWIADKLGAH

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H0GBE3

Antitoxin

Source ID Structure
AlphaFold DB H0GBE4

References