Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 917283..917913 | Replicon | chromosome |
| Accession | NZ_CP120365 | ||
| Organism | Sinorhizobium kummerowiae strain CCBAU 71714 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | H0G1A3 |
| Locus tag | PZL22_RS11465 | Protein ID | WP_003530010.1 |
| Coordinates | 917283..917471 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | H0G1A2 |
| Locus tag | PZL22_RS11470 | Protein ID | WP_003530007.1 |
| Coordinates | 917476..917913 (+) | Length | 146 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZL22_RS11455 (PZL22_002295) | 915184..916155 | - | 972 | WP_003530013.1 | glycosyltransferase family 2 protein | - |
| PZL22_RS11460 (PZL22_002296) | 916336..917058 | - | 723 | WP_244422787.1 | Stf0 family sulphotransferase | - |
| PZL22_RS11465 (PZL22_002297) | 917283..917471 | + | 189 | WP_003530010.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PZL22_RS11470 (PZL22_002298) | 917476..917913 | + | 438 | WP_003530007.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PZL22_RS11475 (PZL22_002299) | 918579..919490 | - | 912 | WP_284718654.1 | PhnA-like protein | - |
| PZL22_RS11480 (PZL22_002300) | 919639..920613 | - | 975 | WP_284718655.1 | non-homologous end-joining DNA ligase | - |
| PZL22_RS11485 (PZL22_002301) | 920743..921195 | + | 453 | WP_127639509.1 | hypothetical protein | - |
| PZL22_RS11490 (PZL22_002302) | 921192..921449 | + | 258 | WP_234840639.1 | hypothetical protein | - |
| PZL22_RS11495 (PZL22_002303) | 921546..922064 | - | 519 | WP_127639508.1 | hypothetical protein | - |
| PZL22_RS11500 (PZL22_002304) | 922181..922603 | - | 423 | WP_088194452.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 887573..971111 | 83538 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6939.09 Da Isoelectric Point: 11.0889
>T274906 WP_003530010.1 NZ_CP120365:917283-917471 [Sinorhizobium kummerowiae]
VKSGDIIAALQKDGWYEVATKGSHVQFKHPKKHGRVTVPHPKRDLPIGTLRSIEKQSGLKLR
VKSGDIIAALQKDGWYEVATKGSHVQFKHPKKHGRVTVPHPKRDLPIGTLRSIEKQSGLKLR
Download Length: 189 bp
Antitoxin
Download Length: 146 a.a. Molecular weight: 15506.32 Da Isoelectric Point: 4.3251
>AT274906 WP_003530007.1 NZ_CP120365:917476-917913 [Sinorhizobium kummerowiae]
MRNYIGLIHKDAESDYGVSFPDFSGVVTAGADLDDARAMAEEALALHIEGLVEDGEAIPEPSSLEVVMSDVENKDCVAIL
VAVKTEAKRAIRVNVTLPEGVLKQIDAFAEAHGLTRSGFLARAATHEIERANDGHDAYAESRLSA
MRNYIGLIHKDAESDYGVSFPDFSGVVTAGADLDDARAMAEEALALHIEGLVEDGEAIPEPSSLEVVMSDVENKDCVAIL
VAVKTEAKRAIRVNVTLPEGVLKQIDAFAEAHGLTRSGFLARAATHEIERANDGHDAYAESRLSA
Download Length: 438 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|