Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 1271398..1272065 | Replicon | plasmid pSkuCCBAU71714b |
| Accession | NZ_CP120364 | ||
| Organism | Sinorhizobium kummerowiae strain CCBAU 71714 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | H0FTU2 |
| Locus tag | PZL22_RS05855 | Protein ID | WP_003525860.1 |
| Coordinates | 1271398..1271841 (-) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q92WE1 |
| Locus tag | PZL22_RS05860 | Protein ID | WP_010975287.1 |
| Coordinates | 1271838..1272065 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZL22_RS05835 (PZL22_001171) | 1266855..1269047 | + | 2193 | WP_127515813.1 | hydantoinase B/oxoprolinase family protein | - |
| PZL22_RS05840 (PZL22_001172) | 1269051..1269548 | + | 498 | WP_003525855.1 | acetone carboxylase subunit gamma | - |
| PZL22_RS05845 (PZL22_001173) | 1269545..1270375 | + | 831 | WP_284718264.1 | SDR family oxidoreductase | - |
| PZL22_RS05850 (PZL22_001174) | 1270444..1271382 | + | 939 | WP_284718493.1 | choline ABC transporter substrate-binding protein | - |
| PZL22_RS05855 (PZL22_001175) | 1271398..1271841 | - | 444 | WP_003525860.1 | PIN domain-containing protein | Toxin |
| PZL22_RS05860 (PZL22_001176) | 1271838..1272065 | - | 228 | WP_010975287.1 | hypothetical protein | Antitoxin |
| PZL22_RS05865 (PZL22_001177) | 1272248..1272721 | - | 474 | WP_003525863.1 | DUF2269 family protein | - |
| PZL22_RS05870 (PZL22_001178) | 1272721..1274010 | - | 1290 | WP_003525864.1 | SDR family oxidoreductase | - |
| PZL22_RS05875 (PZL22_001179) | 1274380..1275672 | + | 1293 | WP_014527485.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| PZL22_RS05880 (PZL22_001180) | 1275789..1276670 | + | 882 | WP_003525869.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | htpB | 1..1543136 | 1543136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 15648.03 Da Isoelectric Point: 7.4215
>T274904 WP_003525860.1 NZ_CP120364:c1271841-1271398 [Sinorhizobium kummerowiae]
VTFLLDVNVLIALIDPSHIGHDDAHEWFASIGQTAWATCPITENGVIRIVGNPKYPNSPGSPLPVMEIVAKLRSLPGHVF
WPDDVSLVGSSDIIPSKILTSGQVTDTYLLALAKVRGGKLATFDRKLSAAAVTKGNSALHLIATNRS
VTFLLDVNVLIALIDPSHIGHDDAHEWFASIGQTAWATCPITENGVIRIVGNPKYPNSPGSPLPVMEIVAKLRSLPGHVF
WPDDVSLVGSSDIIPSKILTSGQVTDTYLLALAKVRGGKLATFDRKLSAAAVTKGNSALHLIATNRS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|