Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 921078..921600 | Replicon | plasmid pSkuCCBAU71714b |
| Accession | NZ_CP120364 | ||
| Organism | Sinorhizobium kummerowiae strain CCBAU 71714 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | PZL22_RS04170 | Protein ID | WP_284718168.1 |
| Coordinates | 921316..921600 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | H0FXK0 |
| Locus tag | PZL22_RS04165 | Protein ID | WP_003527850.1 |
| Coordinates | 921078..921326 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZL22_RS04140 (PZL22_000831) | 916549..917616 | + | 1068 | WP_127613890.1 | ABC transporter substrate-binding protein | - |
| PZL22_RS04145 (PZL22_000832) | 917613..918656 | + | 1044 | WP_003527864.1 | iron ABC transporter permease | - |
| PZL22_RS04150 (PZL22_000833) | 918653..919453 | + | 801 | WP_003527862.1 | ABC transporter ATP-binding protein | - |
| PZL22_RS04155 (PZL22_000834) | 919457..920251 | + | 795 | WP_003527860.1 | methyltransferase domain-containing protein | - |
| PZL22_RS04160 (PZL22_000835) | 920335..920460 | - | 126 | Protein_830 | IS481 family transposase | - |
| PZL22_RS04165 (PZL22_000836) | 921078..921326 | + | 249 | WP_003527850.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| PZL22_RS04170 (PZL22_000837) | 921316..921600 | + | 285 | WP_284718168.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PZL22_RS04175 (PZL22_000838) | 921691..921951 | - | 261 | Protein_833 | helix-turn-helix domain-containing protein | - |
| PZL22_RS04180 (PZL22_000839) | 922532..922930 | + | 399 | WP_003527845.1 | hypothetical protein | - |
| PZL22_RS04185 (PZL22_000840) | 923097..923282 | + | 186 | WP_010974989.1 | hypothetical protein | - |
| PZL22_RS04190 (PZL22_000841) | 923286..923732 | - | 447 | WP_003527841.1 | DNA-binding protein | - |
| PZL22_RS04195 (PZL22_000842) | 924021..924230 | + | 210 | WP_003527838.1 | dodecin family protein | - |
| PZL22_RS04200 (PZL22_000843) | 924765..926144 | + | 1380 | WP_003527829.1 | sodium:alanine symporter family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | htpB | 1..1543136 | 1543136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10885.48 Da Isoelectric Point: 10.3083
>T274903 WP_284718168.1 NZ_CP120364:921316-921600 [Sinorhizobium kummerowiae]
MATELPFRLAPAAKADLRKIWRYTARRWSLEQAETYQDQLYTAFEGLAAGTKKGRNVDVRPGYLKYPAGSHIVYFRDRGD
RIDIIRILHGRMDA
MATELPFRLAPAAKADLRKIWRYTARRWSLEQAETYQDQLYTAFEGLAAGTKKGRNVDVRPGYLKYPAGSHIVYFRDRGD
RIDIIRILHGRMDA
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|