Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 575621..576159 | Replicon | plasmid pSkuCCBAU71714b |
| Accession | NZ_CP120364 | ||
| Organism | Sinorhizobium kummerowiae strain CCBAU 71714 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | H0FUM8 |
| Locus tag | PZL22_RS02595 | Protein ID | WP_003526285.1 |
| Coordinates | 575836..576159 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | H0FUM7 |
| Locus tag | PZL22_RS02590 | Protein ID | WP_003526284.1 |
| Coordinates | 575621..575839 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZL22_RS02550 (PZL22_000512) | 570734..571078 | - | 345 | WP_127594839.1 | hypothetical protein | - |
| PZL22_RS02555 (PZL22_000513) | 571285..572382 | - | 1098 | WP_003526275.1 | DUF475 domain-containing protein | - |
| PZL22_RS02560 (PZL22_000514) | 572804..572989 | + | 186 | WP_234835621.1 | DUF982 domain-containing protein | - |
| PZL22_RS02565 (PZL22_000515) | 573098..573379 | + | 282 | WP_003526277.1 | DUF982 domain-containing protein | - |
| PZL22_RS02570 (PZL22_000516) | 573357..573605 | + | 249 | WP_003526278.1 | DUF982 domain-containing protein | - |
| PZL22_RS02575 (PZL22_000517) | 573773..574195 | + | 423 | WP_003526279.1 | low affinity iron permease family protein | - |
| PZL22_RS02580 (PZL22_000518) | 574299..574670 | + | 372 | WP_284718446.1 | hypothetical protein | - |
| PZL22_RS02585 (PZL22_000519) | 574667..575449 | + | 783 | WP_003526281.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| PZL22_RS02590 (PZL22_000520) | 575621..575839 | + | 219 | WP_003526284.1 | antitoxin MazE family protein | Antitoxin |
| PZL22_RS02595 (PZL22_000521) | 575836..576159 | + | 324 | WP_003526285.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PZL22_RS02600 (PZL22_000522) | 576651..576953 | + | 303 | WP_033048288.1 | DUF6074 family protein | - |
| PZL22_RS02605 (PZL22_000523) | 576998..577258 | - | 261 | WP_003526287.1 | DUF982 domain-containing protein | - |
| PZL22_RS02610 (PZL22_000524) | 577252..577728 | - | 477 | WP_284718447.1 | CBS domain-containing protein | - |
| PZL22_RS02615 (PZL22_000525) | 578027..578290 | - | 264 | WP_033048306.1 | hypothetical protein | - |
| PZL22_RS02620 (PZL22_000526) | 578422..578703 | - | 282 | WP_003526290.1 | DUF1236 domain-containing protein | - |
| PZL22_RS02625 (PZL22_000527) | 578940..579461 | + | 522 | WP_003526296.1 | sigma-70 family RNA polymerase sigma factor | - |
| PZL22_RS02630 (PZL22_000528) | 579500..579658 | - | 159 | WP_164819047.1 | hypothetical protein | - |
| PZL22_RS02635 (PZL22_000529) | 579873..580061 | - | 189 | WP_003526298.1 | DUF3008 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | htpB | 1..1543136 | 1543136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11695.88 Da Isoelectric Point: 10.5806
>T274902 WP_003526285.1 NZ_CP120364:575836-576159 [Sinorhizobium kummerowiae]
MRRGDLVTVAMPGDFGKPRPALIIQADLFEDTGTVTVLLVSEALLDAPLLRPTVRPTRENGLRKPSQIMIDKAMPVKRDK
LGPPFGRLDDQMMLSVARSLAVFLGLA
MRRGDLVTVAMPGDFGKPRPALIIQADLFEDTGTVTVLLVSEALLDAPLLRPTVRPTRENGLRKPSQIMIDKAMPVKRDK
LGPPFGRLDDQMMLSVARSLAVFLGLA
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|