Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 575621..576159 Replicon plasmid pSkuCCBAU71714b
Accession NZ_CP120364
Organism Sinorhizobium kummerowiae strain CCBAU 71714

Toxin (Protein)


Gene name mazF Uniprot ID H0FUM8
Locus tag PZL22_RS02595 Protein ID WP_003526285.1
Coordinates 575836..576159 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID H0FUM7
Locus tag PZL22_RS02590 Protein ID WP_003526284.1
Coordinates 575621..575839 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PZL22_RS02550 (PZL22_000512) 570734..571078 - 345 WP_127594839.1 hypothetical protein -
PZL22_RS02555 (PZL22_000513) 571285..572382 - 1098 WP_003526275.1 DUF475 domain-containing protein -
PZL22_RS02560 (PZL22_000514) 572804..572989 + 186 WP_234835621.1 DUF982 domain-containing protein -
PZL22_RS02565 (PZL22_000515) 573098..573379 + 282 WP_003526277.1 DUF982 domain-containing protein -
PZL22_RS02570 (PZL22_000516) 573357..573605 + 249 WP_003526278.1 DUF982 domain-containing protein -
PZL22_RS02575 (PZL22_000517) 573773..574195 + 423 WP_003526279.1 low affinity iron permease family protein -
PZL22_RS02580 (PZL22_000518) 574299..574670 + 372 WP_284718446.1 hypothetical protein -
PZL22_RS02585 (PZL22_000519) 574667..575449 + 783 WP_003526281.1 SDR family NAD(P)-dependent oxidoreductase -
PZL22_RS02590 (PZL22_000520) 575621..575839 + 219 WP_003526284.1 antitoxin MazE family protein Antitoxin
PZL22_RS02595 (PZL22_000521) 575836..576159 + 324 WP_003526285.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PZL22_RS02600 (PZL22_000522) 576651..576953 + 303 WP_033048288.1 DUF6074 family protein -
PZL22_RS02605 (PZL22_000523) 576998..577258 - 261 WP_003526287.1 DUF982 domain-containing protein -
PZL22_RS02610 (PZL22_000524) 577252..577728 - 477 WP_284718447.1 CBS domain-containing protein -
PZL22_RS02615 (PZL22_000525) 578027..578290 - 264 WP_033048306.1 hypothetical protein -
PZL22_RS02620 (PZL22_000526) 578422..578703 - 282 WP_003526290.1 DUF1236 domain-containing protein -
PZL22_RS02625 (PZL22_000527) 578940..579461 + 522 WP_003526296.1 sigma-70 family RNA polymerase sigma factor -
PZL22_RS02630 (PZL22_000528) 579500..579658 - 159 WP_164819047.1 hypothetical protein -
PZL22_RS02635 (PZL22_000529) 579873..580061 - 189 WP_003526298.1 DUF3008 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - htpB 1..1543136 1543136


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-103)

Antitoxin

Antitoxin MazE-like

(7-70)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 11695.88 Da        Isoelectric Point: 10.5806

>T274902 WP_003526285.1 NZ_CP120364:575836-576159 [Sinorhizobium kummerowiae]
MRRGDLVTVAMPGDFGKPRPALIIQADLFEDTGTVTVLLVSEALLDAPLLRPTVRPTRENGLRKPSQIMIDKAMPVKRDK
LGPPFGRLDDQMMLSVARSLAVFLGLA

Download         Length: 324 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 7844.74 Da        Isoelectric Point: 4.6943

>AT274902 WP_003526284.1 NZ_CP120364:575621-575839 [Sinorhizobium kummerowiae]
MPTPVTQRVQKRRDALRAAGLRPVQIWVPDTRRPGFADECRRQAEAVAAADAADRDLDAFIDAALSDPDGDA

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H0FUM8

Antitoxin

Source ID Structure
AlphaFold DB H0FUM7

References