Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 19820..20631 | Replicon | plasmid unnamed2 |
Accession | NZ_CP120363 | ||
Organism | Chelativorans sp. AA-79 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | - |
Locus tag | PVE73_RS27225 | Protein ID | WP_277367890.1 |
Coordinates | 19820..20356 (-) | Length | 179 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | - |
Locus tag | PVE73_RS27230 | Protein ID | WP_277367891.1 |
Coordinates | 20353..20631 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVE73_RS27195 (PVE73_27195) | 14894..15313 | - | 420 | WP_277367884.1 | hypothetical protein | - |
PVE73_RS27200 (PVE73_27200) | 15393..16310 | - | 918 | WP_277367885.1 | hypothetical protein | - |
PVE73_RS27205 (PVE73_27205) | 16875..17792 | - | 918 | WP_277367886.1 | zincin-like metallopeptidase domain-containing protein | - |
PVE73_RS27210 (PVE73_27210) | 18013..18543 | + | 531 | WP_277367887.1 | hypothetical protein | - |
PVE73_RS27215 (PVE73_27215) | 18695..19192 | + | 498 | WP_277367888.1 | MucR family transcriptional regulator | - |
PVE73_RS27220 (PVE73_27220) | 19203..19796 | + | 594 | WP_277367889.1 | SOS response-associated peptidase family protein | - |
PVE73_RS27225 (PVE73_27225) | 19820..20356 | - | 537 | WP_277367890.1 | GNAT family N-acetyltransferase | Toxin |
PVE73_RS27230 (PVE73_27230) | 20353..20631 | - | 279 | WP_277367891.1 | DUF1778 domain-containing protein | Antitoxin |
PVE73_RS27235 (PVE73_27235) | 20749..24012 | - | 3264 | WP_277367892.1 | error-prone DNA polymerase | - |
PVE73_RS27240 (PVE73_27240) | 24009..25529 | - | 1521 | WP_277367893.1 | DNA polymerase Y family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..219481 | 219481 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 179 a.a. Molecular weight: 19100.84 Da Isoelectric Point: 8.4742
>T274901 WP_277367890.1 NZ_CP120363:c20356-19820 [Chelativorans sp. AA-79]
MTLPDWREEPIAKAHDRKGFDCGQPELNDFLMRYARQASESGASKTYVAVDSGNRTTILGFYTLSPAQIDFEAVPDVARP
AGGGRHAIGGFRLGRLAVATAHQGHGLGGELLIAAARRCIRASTEVGGTLLFIDAKDERAAAWYRSYGAVTIPKAPLSLV
LPYSVFIAVMEQAGKPII
MTLPDWREEPIAKAHDRKGFDCGQPELNDFLMRYARQASESGASKTYVAVDSGNRTTILGFYTLSPAQIDFEAVPDVARP
AGGGRHAIGGFRLGRLAVATAHQGHGLGGELLIAAARRCIRASTEVGGTLLFIDAKDERAAAWYRSYGAVTIPKAPLSLV
LPYSVFIAVMEQAGKPII
Download Length: 537 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|