Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 3225661..3226147 | Replicon | chromosome |
Accession | NZ_CP120361 | ||
Organism | Chelativorans sp. AA-79 |
Toxin (Protein)
Gene name | pasB | Uniprot ID | - |
Locus tag | PVE73_RS15775 | Protein ID | WP_277363156.1 |
Coordinates | 3225878..3226147 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | - |
Locus tag | PVE73_RS15770 | Protein ID | WP_277363155.1 |
Coordinates | 3225661..3225894 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVE73_RS15740 (PVE73_15740) | 3220960..3221325 | - | 366 | WP_277363152.1 | NADH-quinone oxidoreductase subunit A | - |
PVE73_RS15745 (PVE73_15745) | 3221709..3222980 | + | 1272 | WP_277363153.1 | winged helix-turn-helix domain-containing protein | - |
PVE73_RS15750 (PVE73_15750) | 3222999..3223163 | - | 165 | WP_277367474.1 | biotin/lipoyl-containing protein | - |
PVE73_RS15755 (PVE73_15755) | 3223138..3223197 | - | 60 | Protein_3111 | hypothetical protein | - |
PVE73_RS15760 (PVE73_15760) | 3223290..3225011 | - | 1722 | Protein_3112 | acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha | - |
PVE73_RS15765 (PVE73_15765) | 3225138..3225596 | + | 459 | WP_277363154.1 | YaiI/YqxD family protein | - |
PVE73_RS15770 (PVE73_15770) | 3225661..3225894 | + | 234 | WP_277363155.1 | DUF6290 family protein | Antitoxin |
PVE73_RS15775 (PVE73_15775) | 3225878..3226147 | + | 270 | WP_277363156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PVE73_RS15780 (PVE73_15780) | 3226492..3227586 | + | 1095 | WP_277363157.1 | glycine cleavage system aminomethyltransferase GcvT | - |
PVE73_RS15785 (PVE73_15785) | 3227591..3227959 | + | 369 | WP_277363158.1 | glycine cleavage system protein GcvH | - |
PVE73_RS15790 (PVE73_15790) | 3227970..3230765 | + | 2796 | WP_277363159.1 | aminomethyl-transferring glycine dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10634.42 Da Isoelectric Point: 10.5737
>T274900 WP_277363156.1 NZ_CP120361:3225878-3226147 [Chelativorans sp. AA-79]
MTWTIEVDDAALRQLKKIGRVESKRIYGFLRERIATLDNPRKLGAALQGSRFEHLWRYRVGDYRIICDIQDHKLVVLVLQ
IGHRREIYR
MTWTIEVDDAALRQLKKIGRVESKRIYGFLRERIATLDNPRKLGAALQGSRFEHLWRYRVGDYRIICDIQDHKLVVLVLQ
IGHRREIYR
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|