Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 2150803..2151287 Replicon chromosome
Accession NZ_CP120361
Organism Chelativorans sp. AA-79

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag PVE73_RS10375 Protein ID WP_277366862.1
Coordinates 2150803..2151069 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag PVE73_RS10380 Protein ID WP_277366863.1
Coordinates 2151066..2151287 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVE73_RS10345 (PVE73_10345) 2146587..2147900 + 1314 WP_277366856.1 NAD-dependent dihydropyrimidine dehydrogenase subunit PreA -
PVE73_RS10350 (PVE73_10350) 2147931..2148602 - 672 WP_277366857.1 glutathione S-transferase family protein -
PVE73_RS10355 (PVE73_10355) 2148719..2149153 + 435 WP_277366858.1 MarR family transcriptional regulator -
PVE73_RS10360 (PVE73_10360) 2149285..2149806 + 522 WP_277366859.1 Rrf2 family transcriptional regulator -
PVE73_RS10365 (PVE73_10365) 2149818..2150288 + 471 WP_277366860.1 carboxymuconolactone decarboxylase family protein -
PVE73_RS10370 (PVE73_10370) 2150376..2150747 + 372 WP_277366861.1 DoxX family protein -
PVE73_RS10375 (PVE73_10375) 2150803..2151069 + 267 WP_277366862.1 BrnT family toxin Toxin
PVE73_RS10380 (PVE73_10380) 2151066..2151287 + 222 WP_277366863.1 CopG family antitoxin Antitoxin
PVE73_RS10385 (PVE73_10385) 2151293..2152360 - 1068 WP_277366864.1 3-carboxy-cis,cis-muconate cycloisomerase -
PVE73_RS10390 (PVE73_10390) 2152367..2152978 - 612 WP_277367411.1 protocatechuate 3,4-dioxygenase subunit alpha -
PVE73_RS10395 (PVE73_10395) 2152981..2153721 - 741 WP_277366865.1 protocatechuate 3,4-dioxygenase subunit beta -
PVE73_RS10400 (PVE73_10400) 2153718..2154119 - 402 WP_277366866.1 4-carboxymuconolactone decarboxylase -
PVE73_RS10405 (PVE73_10405) 2154346..2155164 + 819 WP_277366867.1 helix-turn-helix domain-containing protein -
PVE73_RS10410 (PVE73_10410) 2155208..2155440 + 233 Protein_2063 BrnT family toxin -
PVE73_RS10415 (PVE73_10415) 2155400..2155657 + 258 WP_277366868.1 BrnA antitoxin family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(5-80)

Antitoxin

CopG antitoxin

(7-70)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10436.75 Da        Isoelectric Point: 6.2308

>T274899 WP_277366862.1 NZ_CP120361:2150803-2151069 [Chelativorans sp. AA-79]
MEFEYDPEKSARNRAKHGIDFEEAQALWLDEWLLEVSARTVDEPRYLAIGTLGGKHWTAVFTRRNGRIRLMSVRCSREQE
VRHYEDVI

Download         Length: 267 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8213.32 Da        Isoelectric Point: 4.7571

>AT274899 WP_277366863.1 NZ_CP120361:2151066-2151287 [Chelativorans sp. AA-79]
MKVKAAEFDEAFDAGEDVSDLVDWGASRRPNLETRRVNVDFPAWVVEGLDQQAKKLGVSRQALIKLWIAERLG

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References