Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN-MazE
Location 875364..876009 Replicon chromosome
Accession NZ_CP120361
Organism Chelativorans sp. AA-79

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PVE73_RS04425 Protein ID WP_277365778.1
Coordinates 875364..875789 (-) Length 142 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag PVE73_RS04430 Protein ID WP_277365779.1
Coordinates 875779..876009 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVE73_RS04395 (PVE73_04395) 870815..871111 - 297 WP_277365773.1 sarcosine oxidase subunit delta -
PVE73_RS04400 (PVE73_04400) 871121..872374 - 1254 WP_277365774.1 sarcosine oxidase subunit beta family protein -
PVE73_RS04405 (PVE73_04405) 872578..873336 + 759 WP_277365775.1 SDR family oxidoreductase -
PVE73_RS04410 (PVE73_04410) 873488..873715 + 228 WP_028033117.1 30S ribosomal protein S21 -
PVE73_RS04415 (PVE73_04415) 873845..874720 + 876 WP_277365776.1 tetratricopeptide repeat protein -
PVE73_RS04420 (PVE73_04420) 874830..875321 + 492 WP_277365777.1 DUF992 domain-containing protein -
PVE73_RS04425 (PVE73_04425) 875364..875789 - 426 WP_277365778.1 PIN domain-containing protein Toxin
PVE73_RS04430 (PVE73_04430) 875779..876009 - 231 WP_277365779.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
PVE73_RS04435 (PVE73_04435) 876115..877512 - 1398 WP_277365780.1 NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta -
PVE73_RS04440 (PVE73_04440) 877514..877939 - 426 WP_277365781.1 NAD(P) transhydrogenase subunit alpha -
PVE73_RS04445 (PVE73_04445) 877939..879282 - 1344 WP_277365782.1 Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha -
PVE73_RS04450 (PVE73_04450) 879342..879569 - 228 WP_277365783.1 aa3-type cytochrome c oxidase subunit IV -
PVE73_RS04455 (PVE73_04455) 879700..879990 - 291 WP_277365784.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(13-122)

Antitoxin

SpoVT-AbrB domain

(5-37)


Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 15656.80 Da        Isoelectric Point: 5.7544

>T274898 WP_277365778.1 NZ_CP120361:c875789-875364 [Chelativorans sp. AA-79]
MPDRRGGAPSSAFIDTNVILYLASDDQRKAERAEGIVRQGGTISVQVLNEIANAGRRKMRLDWQQLHDFIDAIRRLLRVE
SLTVDVHESGMAIAERYGVSIYDGLIVASALQAGCTILWSEDMQDRLAIGDLRIANPFRTS

Download         Length: 426 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.22 Da        Isoelectric Point: 10.7217

>AT274898 WP_277365779.1 NZ_CP120361:c876009-875779 [Chelativorans sp. AA-79]
MRVSRWGNSLAIRLPSSVVQLLKLEEGDEIELHAQGMRSLAVAKKPEREELLTRLRHFRGKLPADFRFDRDELNAR

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References