Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 875364..876009 | Replicon | chromosome |
| Accession | NZ_CP120361 | ||
| Organism | Chelativorans sp. AA-79 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PVE73_RS04425 | Protein ID | WP_277365778.1 |
| Coordinates | 875364..875789 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PVE73_RS04430 | Protein ID | WP_277365779.1 |
| Coordinates | 875779..876009 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVE73_RS04395 (PVE73_04395) | 870815..871111 | - | 297 | WP_277365773.1 | sarcosine oxidase subunit delta | - |
| PVE73_RS04400 (PVE73_04400) | 871121..872374 | - | 1254 | WP_277365774.1 | sarcosine oxidase subunit beta family protein | - |
| PVE73_RS04405 (PVE73_04405) | 872578..873336 | + | 759 | WP_277365775.1 | SDR family oxidoreductase | - |
| PVE73_RS04410 (PVE73_04410) | 873488..873715 | + | 228 | WP_028033117.1 | 30S ribosomal protein S21 | - |
| PVE73_RS04415 (PVE73_04415) | 873845..874720 | + | 876 | WP_277365776.1 | tetratricopeptide repeat protein | - |
| PVE73_RS04420 (PVE73_04420) | 874830..875321 | + | 492 | WP_277365777.1 | DUF992 domain-containing protein | - |
| PVE73_RS04425 (PVE73_04425) | 875364..875789 | - | 426 | WP_277365778.1 | PIN domain-containing protein | Toxin |
| PVE73_RS04430 (PVE73_04430) | 875779..876009 | - | 231 | WP_277365779.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PVE73_RS04435 (PVE73_04435) | 876115..877512 | - | 1398 | WP_277365780.1 | NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta | - |
| PVE73_RS04440 (PVE73_04440) | 877514..877939 | - | 426 | WP_277365781.1 | NAD(P) transhydrogenase subunit alpha | - |
| PVE73_RS04445 (PVE73_04445) | 877939..879282 | - | 1344 | WP_277365782.1 | Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha | - |
| PVE73_RS04450 (PVE73_04450) | 879342..879569 | - | 228 | WP_277365783.1 | aa3-type cytochrome c oxidase subunit IV | - |
| PVE73_RS04455 (PVE73_04455) | 879700..879990 | - | 291 | WP_277365784.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15656.80 Da Isoelectric Point: 5.7544
>T274898 WP_277365778.1 NZ_CP120361:c875789-875364 [Chelativorans sp. AA-79]
MPDRRGGAPSSAFIDTNVILYLASDDQRKAERAEGIVRQGGTISVQVLNEIANAGRRKMRLDWQQLHDFIDAIRRLLRVE
SLTVDVHESGMAIAERYGVSIYDGLIVASALQAGCTILWSEDMQDRLAIGDLRIANPFRTS
MPDRRGGAPSSAFIDTNVILYLASDDQRKAERAEGIVRQGGTISVQVLNEIANAGRRKMRLDWQQLHDFIDAIRRLLRVE
SLTVDVHESGMAIAERYGVSIYDGLIVASALQAGCTILWSEDMQDRLAIGDLRIANPFRTS
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|