Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 828392..829056 | Replicon | chromosome |
Accession | NZ_CP120361 | ||
Organism | Chelativorans sp. AA-79 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PVE73_RS04200 | Protein ID | WP_277365739.1 |
Coordinates | 828649..829056 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | - |
Locus tag | PVE73_RS04195 | Protein ID | WP_277365738.1 |
Coordinates | 828392..828652 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVE73_RS04170 (PVE73_04170) | 824409..824774 | - | 366 | WP_277365735.1 | hydroxyisourate hydrolase | - |
PVE73_RS04175 (PVE73_04175) | 824950..826383 | + | 1434 | WP_277367341.1 | allantoinase PuuE | - |
PVE73_RS04180 (PVE73_04180) | 826380..827213 | + | 834 | WP_277365736.1 | bifunctional allantoicase/(S)-ureidoglycine aminohydrolase | - |
PVE73_RS04185 (PVE73_04185) | 827235..827735 | + | 501 | WP_277367342.1 | ureidoglycolate lyase | - |
PVE73_RS04190 (PVE73_04190) | 827732..828331 | + | 600 | WP_277365737.1 | nucleoside deaminase | - |
PVE73_RS04195 (PVE73_04195) | 828392..828652 | + | 261 | WP_277365738.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PVE73_RS04200 (PVE73_04200) | 828649..829056 | + | 408 | WP_277365739.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PVE73_RS04205 (PVE73_04205) | 829154..830359 | - | 1206 | WP_277365740.1 | 3-oxoadipyl-CoA thiolase | - |
PVE73_RS04210 (PVE73_04210) | 830352..831164 | - | 813 | WP_277365741.1 | CoA-transferase subunit beta | - |
PVE73_RS04215 (PVE73_04215) | 831161..832018 | - | 858 | WP_277365742.1 | CoA-transferase | - |
PVE73_RS04220 (PVE73_04220) | 832076..832870 | + | 795 | WP_277365743.1 | IclR family transcriptional regulator C-terminal domain-containing protein | - |
PVE73_RS04225 (PVE73_04225) | 832894..833118 | - | 225 | WP_277365744.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14923.30 Da Isoelectric Point: 9.0921
>T274897 WP_277365739.1 NZ_CP120361:828649-829056 [Chelativorans sp. AA-79]
MKPPFMLDTNVVSAFMHGRSRALDRRISAYGKDDLCVSVVSYGETRYGLALRPGAKHLAAAAELLFGLVKISPWTPEAAC
RYGEMRAELRRRGRTMQPLDMLIAAHALEAGATLVTSDRAFRFVPGLAVENWLDD
MKPPFMLDTNVVSAFMHGRSRALDRRISAYGKDDLCVSVVSYGETRYGLALRPGAKHLAAAAELLFGLVKISPWTPEAAC
RYGEMRAELRRRGRTMQPLDMLIAAHALEAGATLVTSDRAFRFVPGLAVENWLDD
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|