Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 122161..122713 | Replicon | chromosome |
Accession | NZ_CP120360 | ||
Organism | Janibacter sp. DB-40 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PVE36_RS00635 | Protein ID | WP_277453912.1 |
Coordinates | 122161..122475 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PVE36_RS00640 | Protein ID | WP_277453914.1 |
Coordinates | 122480..122713 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVE36_RS00615 | 117510..118921 | + | 1412 | Protein_119 | FGGY family carbohydrate kinase | - |
PVE36_RS00620 | 118942..119979 | - | 1038 | WP_277453909.1 | zinc-dependent alcohol dehydrogenase family protein | - |
PVE36_RS00625 | 120035..121369 | + | 1335 | WP_277453910.1 | alpha-hydroxy-acid oxidizing protein | - |
PVE36_RS00630 | 121399..122109 | - | 711 | WP_277453911.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
PVE36_RS00635 | 122161..122475 | - | 315 | WP_277453912.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PVE36_RS00640 | 122480..122713 | - | 234 | WP_277453914.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PVE36_RS00645 | 122793..124316 | - | 1524 | WP_277453916.1 | fused MFS/spermidine synthase | - |
PVE36_RS00650 | 124361..125137 | + | 777 | WP_277453918.1 | hypothetical protein | - |
PVE36_RS00655 | 125208..126392 | + | 1185 | WP_277453919.1 | TIGR04053 family radical SAM/SPASM domain-containing protein | - |
PVE36_RS00660 | 126415..127629 | - | 1215 | WP_277453920.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11058.81 Da Isoelectric Point: 5.0937
>T274896 WP_277453912.1 NZ_CP120360:c122475-122161 [Janibacter sp. DB-40]
VREICLVRLDKTRPALVLTRETARGAMTKVTLAPITTTIKGLSSEVRVGPANGLDQDCAVALDNVVTVPVERLGRTVGYL
SAAQEDELARAVVLAYDLDLPLSG
VREICLVRLDKTRPALVLTRETARGAMTKVTLAPITTTIKGLSSEVRVGPANGLDQDCAVALDNVVTVPVERLGRTVGYL
SAAQEDELARAVVLAYDLDLPLSG
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|