Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 4565272..4565813 | Replicon | chromosome |
| Accession | NZ_CP120359 | ||
| Organism | Pseudomonas sp. AA-38 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PVE35_RS21035 | Protein ID | WP_277372878.1 |
| Coordinates | 4565517..4565813 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PVE35_RS21030 | Protein ID | WP_277372877.1 |
| Coordinates | 4565272..4565529 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVE35_RS21005 | 4560412..4561443 | - | 1032 | WP_277372873.1 | ABC transporter ATP-binding protein | - |
| PVE35_RS21010 | 4561440..4562234 | - | 795 | WP_277372874.1 | ABC transporter permease subunit | - |
| PVE35_RS21015 | 4562231..4563088 | - | 858 | WP_277374917.1 | ABC transporter permease | - |
| PVE35_RS21020 | 4563102..4564106 | - | 1005 | WP_277372875.1 | ABC transporter substrate-binding protein | - |
| PVE35_RS21025 | 4564090..4565109 | - | 1020 | WP_277372876.1 | substrate-binding domain-containing protein | - |
| PVE35_RS21030 | 4565272..4565529 | + | 258 | WP_277372877.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PVE35_RS21035 | 4565517..4565813 | + | 297 | WP_277372878.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PVE35_RS21040 | 4565817..4567136 | - | 1320 | WP_277372879.1 | metallopeptidase TldD-related protein | - |
| PVE35_RS21045 | 4567136..4568578 | - | 1443 | WP_277372880.1 | TldD/PmbA family protein | - |
| PVE35_RS21050 | 4568675..4569238 | - | 564 | WP_277372881.1 | TetR/AcrR family transcriptional regulator | - |
| PVE35_RS21055 | 4569418..4570080 | + | 663 | WP_277374918.1 | glutathione S-transferase | - |
| PVE35_RS21060 | 4570334..4570477 | - | 144 | WP_268184384.1 | DUF2474 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11185.11 Da Isoelectric Point: 6.2284
>T274895 WP_277372878.1 NZ_CP120359:4565517-4565813 [Pseudomonas sp. AA-38]
MAEIVWTNPALEQLDELAHYIALDKPDAARALVRKVVEAVARLAEFPLSGRVPGELPDSVYREIVVPPCRVFYRPAEGKV
FIIHIMREERLLRAHLLE
MAEIVWTNPALEQLDELAHYIALDKPDAARALVRKVVEAVARLAEFPLSGRVPGELPDSVYREIVVPPCRVFYRPAEGKV
FIIHIMREERLLRAHLLE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|