Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 1157130..1157623 | Replicon | chromosome |
Accession | NZ_CP120352 | ||
Organism | Ligilactobacillus murinus strain PG1-1-10 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A829DKF8 |
Locus tag | P2T63_RS05830 | Protein ID | WP_004047837.1 |
Coordinates | 1157348..1157623 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A829DFA4 |
Locus tag | P2T63_RS05825 | Protein ID | WP_004047835.1 |
Coordinates | 1157130..1157351 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2T63_RS05810 (P2T63_05810) | 1152540..1153262 | - | 723 | WP_179936176.1 | IS30 family transposase | - |
P2T63_RS05815 (P2T63_05815) | 1153422..1154594 | - | 1173 | WP_004050661.1 | IS256 family transposase | - |
P2T63_RS05820 (P2T63_05820) | 1155361..1155627 | + | 267 | WP_148458380.1 | hypothetical protein | - |
P2T63_RS05825 (P2T63_05825) | 1157130..1157351 | + | 222 | WP_004047835.1 | DUF6290 family protein | Antitoxin |
P2T63_RS05830 (P2T63_05830) | 1157348..1157623 | + | 276 | WP_004047837.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P2T63_RS05835 (P2T63_05835) | 1157886..1158617 | - | 732 | Protein_1097 | 5'-nucleotidase, lipoprotein e(P4) family | - |
P2T63_RS05840 (P2T63_05840) | 1158818..1159111 | + | 294 | WP_004047845.1 | hypothetical protein | - |
P2T63_RS05845 (P2T63_05845) | 1159206..1159808 | + | 603 | WP_039936077.1 | glycerol-3-phosphate 1-O-acyltransferase PlsY | - |
P2T63_RS05850 (P2T63_05850) | 1159991..1161415 | - | 1425 | WP_004047857.1 | ATP-dependent protease ATPase subunit HslU | - |
P2T63_RS05855 (P2T63_05855) | 1161436..1161978 | - | 543 | WP_004047858.1 | ATP-dependent protease subunit HslV | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1153422..1154594 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10984.72 Da Isoelectric Point: 10.2588
>T274887 WP_004047837.1 NZ_CP120352:1157348-1157623 [Ligilactobacillus murinus]
MKEYHVEYSKRAQKQIKKLDRQIQRLLFAWIDKNLEGVSDPRIHGKGLTGNHAREWRYRIGDYRLICDIQDDIMIILALE
FGHRRSVYNKK
MKEYHVEYSKRAQKQIKKLDRQIQRLLFAWIDKNLEGVSDPRIHGKGLTGNHAREWRYRIGDYRLICDIQDDIMIILALE
FGHRRSVYNKK
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829DKF8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829DFA4 |