Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 48629..49272 | Replicon | plasmid pESI |
| Accession | NZ_CP120348 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_2_2021 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A5T8FJ24 |
| Locus tag | P1828_RS24055 | Protein ID | WP_023994137.1 |
| Coordinates | 48629..49045 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A5T3Q059 |
| Locus tag | P1828_RS24060 | Protein ID | WP_023994136.1 |
| Coordinates | 49042..49272 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1828_RS24025 (P1828_24025) | 44109..44900 | + | 792 | WP_023994142.1 | F4 (K88) fimbria minor subunit FaeH | - |
| P1828_RS24030 (P1828_24030) | 44928..45692 | + | 765 | WP_023994141.1 | minor fimbrial protein | - |
| P1828_RS24035 (P1828_24035) | 45895..46485 | + | 591 | WP_023994140.1 | hypothetical protein | - |
| P1828_RS24040 (P1828_24040) | 46551..46763 | + | 213 | WP_023994139.1 | FaeA/PapI family transcriptional regulator | - |
| P1828_RS24045 (P1828_24045) | 47024..47185 | + | 162 | WP_001816720.1 | hypothetical protein | - |
| P1828_RS24050 (P1828_24050) | 47211..48059 | + | 849 | WP_023994138.1 | SdiA-regulated domain-containing protein | - |
| P1828_RS24055 (P1828_24055) | 48629..49045 | - | 417 | WP_023994137.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P1828_RS24060 (P1828_24060) | 49042..49272 | - | 231 | WP_023994136.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P1828_RS24065 (P1828_24065) | 49896..50114 | + | 219 | WP_023994135.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| P1828_RS24070 (P1828_24070) | 50116..50421 | + | 306 | WP_023994134.1 | type II toxin-antitoxin system toxin CcdB | - |
| P1828_RS24075 (P1828_24075) | 50423..50713 | + | 291 | WP_023994133.1 | hypothetical protein | - |
| P1828_RS24080 (P1828_24080) | 50710..50985 | + | 276 | Protein_59 | 3'-5' exonuclease | - |
| P1828_RS24085 (P1828_24085) | 51056..51172 | + | 117 | Protein_60 | hypothetical protein | - |
| P1828_RS24090 (P1828_24090) | 51162..51877 | - | 716 | Protein_61 | transposase | - |
| P1828_RS24095 (P1828_24095) | 53159..53695 | + | 537 | WP_023994130.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / qacE / sul1 / tet(A) / dfrA14 | faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..285075 | 285075 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15123.58 Da Isoelectric Point: 8.5291
>T274867 WP_023994137.1 NZ_CP120348:c49045-48629 [Salmonella enterica subsp. enterica serovar Muenchen]
VKKMYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVNATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWGR
VKKMYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVNATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWGR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5T8FJ24 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5T3Q059 |