Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacT-ataR/DUF1778(antitoxin)
Location 28610..29367 Replicon plasmid pESI
Accession NZ_CP120348
Organism Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_2_2021

Toxin (Protein)


Gene name tacT Uniprot ID A0A241PXX4
Locus tag P1828_RS23935 Protein ID WP_023994162.1
Coordinates 28885..29367 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID A0A727Z1I8
Locus tag P1828_RS23930 Protein ID WP_001195098.1
Coordinates 28610..28894 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1828_RS23885 (P1828_23885) 24451..24597 - 147 Protein_20 IS66 family insertion sequence element accessory protein TnpB -
P1828_RS23890 (P1828_23890) 24584..24913 - 330 WP_023994169.1 hypothetical protein -
P1828_RS23895 (P1828_23895) 25037..25890 + 854 Protein_22 site-specific tyrosine recombinase XerC -
P1828_RS23900 (P1828_23900) 25859..26146 + 288 WP_031619580.1 damage-inducible protein J -
P1828_RS23905 (P1828_23905) 26143..26448 + 306 WP_023994167.1 type II toxin-antitoxin system RelE/ParE family toxin -
P1828_RS23910 (P1828_23910) 27198..27461 + 264 WP_023994165.1 DUF977 family protein -
P1828_RS23915 (P1828_23915) 27487..27822 + 336 WP_023994164.1 hypothetical protein -
P1828_RS23920 (P1828_23920) 28044..28241 - 198 Protein_27 PIN domain-containing protein -
P1828_RS23925 (P1828_23925) 28365..28454 + 90 WP_071790431.1 helix-turn-helix domain-containing protein -
P1828_RS23930 (P1828_23930) 28610..28894 + 285 WP_001195098.1 DUF1778 domain-containing protein Antitoxin
P1828_RS23935 (P1828_23935) 28885..29367 + 483 WP_023994162.1 GNAT family N-acetyltransferase Toxin
P1828_RS23940 (P1828_23940) 29682..30108 + 427 Protein_31 transposase -
P1828_RS23945 (P1828_23945) 30425..30634 + 210 WP_023994160.1 hemolysin expression modulator Hha -
P1828_RS23950 (P1828_23950) 30708..31060 - 353 Protein_33 transposase -
P1828_RS23955 (P1828_23955) 31287..32260 + 974 Protein_34 IS256 family transposase -
P1828_RS23960 (P1828_23960) 32262..32504 + 243 WP_023994156.1 hypothetical protein -
P1828_RS23965 (P1828_23965) 32575..33531 + 957 WP_023994155.1 Rpn family recombination-promoting nuclease/putative transposase -
P1828_RS23970 (P1828_23970) 33590..33802 + 213 WP_023994154.1 hypothetical protein -
P1828_RS23975 (P1828_23975) 33844..34095 - 252 WP_023994153.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / qacE / sul1 / tet(A) / dfrA14 faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS 1..285075 285075
- inside IScluster/Tn - - 23155..35659 12504


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(31-149)

Antitoxin

Vibrio phage ICP1, Orf50

(13-88)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17971.54 Da        Isoelectric Point: 6.8521

>T274866 WP_023994162.1 NZ_CP120348:28885-29367 [Salmonella enterica subsp. enterica serovar Muenchen]
MEISVTAPELLNEEHYLQQFDCGNDVLSDWLRRRAMKNQYLNASRTFVICPEGTKRVVGYYSIATGSVSHASLGRSLRQN
MPDPVPVVLLGRLAVDECTQGHSFGKWLLNDAVTRVSNLADQVGIKAIMVHAIDEQAKTFYEYFGFVQSPIAPNTLFYKI

Download         Length: 483 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10964.52 Da        Isoelectric Point: 9.6539

>AT274866 WP_001195098.1 NZ_CP120348:28610-28894 [Salmonella enterica subsp. enterica serovar Muenchen]
MQTTIRKSVRNKQINIRATDEERAVIDYAASLVSKNRTDFIIEKAVSEAQNIILDQRVFVLDDARYQAFIKQLEAPVQNT
EGRQRLMDVKPEWK

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A241PXX4

Antitoxin

Source ID Structure
AlphaFold DB A0A727Z1I8

References