Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 14530..15120 | Replicon | plasmid pESI |
| Accession | NZ_CP120348 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_2_2021 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A241PXU0 |
| Locus tag | P1828_RS23850 | Protein ID | WP_023994178.1 |
| Coordinates | 14788..15120 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A5T3Q5H6 |
| Locus tag | P1828_RS23845 | Protein ID | WP_023994179.1 |
| Coordinates | 14530..14787 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1828_RS23825 (P1828_23825) | 10029..11054 | + | 1026 | WP_023994180.1 | IS630 family transposase | - |
| P1828_RS23830 (P1828_23830) | 11058..12077 | - | 1020 | WP_223155817.1 | hypothetical protein | - |
| P1828_RS23835 (P1828_23835) | 12217..12723 | - | 507 | WP_223155815.1 | hypothetical protein | - |
| P1828_RS23840 (P1828_23840) | 12834..13919 | - | 1086 | WP_223155813.1 | hypothetical protein | - |
| P1828_RS23845 (P1828_23845) | 14530..14787 | + | 258 | WP_023994179.1 | hypothetical protein | Antitoxin |
| P1828_RS23850 (P1828_23850) | 14788..15120 | + | 333 | WP_023994178.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| P1828_RS23855 (P1828_23855) | 15720..16325 | + | 606 | Protein_14 | IS481 family transposase | - |
| P1828_RS23860 (P1828_23860) | 16624..18846 | - | 2223 | WP_023994175.1 | DEAD/DEAH box helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / qacE / sul1 / tet(A) / dfrA14 | faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..285075 | 285075 | |
| - | inside | IScluster/Tn | - | - | 10017..16325 | 6308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11787.54 Da Isoelectric Point: 9.3417
>T274865 WP_023994178.1 NZ_CP120348:14788-15120 [Salmonella enterica subsp. enterica serovar Muenchen]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGDFARTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGDFARTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A241PXU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5T3Q5H6 |