Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 49898..50423 | Replicon | plasmid pESI |
| Accession | NZ_CP120346 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_3_2021 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A5Y5FBU7 |
| Locus tag | P1706_RS24055 | Protein ID | WP_023994134.1 |
| Coordinates | 50118..50423 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A5T8X4Y4 |
| Locus tag | P1706_RS24050 | Protein ID | WP_023994135.1 |
| Coordinates | 49898..50116 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1706_RS24015 (P1706_24015) | 44930..45694 | + | 765 | WP_023994141.1 | minor fimbrial protein | - |
| P1706_RS24020 (P1706_24020) | 45897..46487 | + | 591 | WP_023994140.1 | hypothetical protein | - |
| P1706_RS24025 (P1706_24025) | 46553..46765 | + | 213 | WP_023994139.1 | FaeA/PapI family transcriptional regulator | - |
| P1706_RS24030 (P1706_24030) | 47026..47187 | + | 162 | WP_001816720.1 | hypothetical protein | - |
| P1706_RS24035 (P1706_24035) | 47213..48061 | + | 849 | WP_023994138.1 | SdiA-regulated domain-containing protein | - |
| P1706_RS24040 (P1706_24040) | 48631..49047 | - | 417 | WP_023994137.1 | type II toxin-antitoxin system VapC family toxin | - |
| P1706_RS24045 (P1706_24045) | 49044..49274 | - | 231 | WP_023994136.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| P1706_RS24050 (P1706_24050) | 49898..50116 | + | 219 | WP_023994135.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| P1706_RS24055 (P1706_24055) | 50118..50423 | + | 306 | WP_023994134.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| P1706_RS24060 (P1706_24060) | 50425..50715 | + | 291 | WP_023994133.1 | hypothetical protein | - |
| P1706_RS24065 (P1706_24065) | 50712..50987 | + | 276 | Protein_59 | 3'-5' exonuclease | - |
| P1706_RS24070 (P1706_24070) | 51058..51174 | + | 117 | Protein_60 | hypothetical protein | - |
| P1706_RS24075 (P1706_24075) | 51164..51879 | - | 716 | Protein_61 | transposase | - |
| P1706_RS24080 (P1706_24080) | 53161..53697 | + | 537 | WP_023994130.1 | fimbrial protein | - |
| P1706_RS24085 (P1706_24085) | 53750..54481 | + | 732 | WP_023994129.1 | fimbria/pilus periplasmic chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / qacE / sul1 / tet(A) / dfrA14 | faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..285070 | 285070 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11708.47 Da Isoelectric Point: 6.4685
>T274850 WP_023994134.1 NZ_CP120346:50118-50423 [Salmonella enterica subsp. enterica serovar Muenchen]
MQFKVYTYKRESRYRLFVDVQSDIVDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASFIGEEV
AELSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIVDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASFIGEEV
AELSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Y5FBU7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5T8X4Y4 |