Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
| Location | 28610..29367 | Replicon | plasmid pESI |
| Accession | NZ_CP120344 | ||
| Organism | Salmonella enterica subsp. enterica serovar Paratyphi B strain PS_Mu_4_2021 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A241PXX4 |
| Locus tag | P1708_RS23925 | Protein ID | WP_023994162.1 |
| Coordinates | 28885..29367 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A727Z1I8 |
| Locus tag | P1708_RS23920 | Protein ID | WP_001195098.1 |
| Coordinates | 28610..28894 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1708_RS23875 (P1708_23875) | 24451..24597 | - | 147 | Protein_20 | IS66 family insertion sequence element accessory protein TnpB | - |
| P1708_RS23880 (P1708_23880) | 24584..24913 | - | 330 | WP_023994169.1 | hypothetical protein | - |
| P1708_RS23885 (P1708_23885) | 25037..25890 | + | 854 | Protein_22 | site-specific tyrosine recombinase XerC | - |
| P1708_RS23890 (P1708_23890) | 25859..26146 | + | 288 | WP_031619580.1 | damage-inducible protein J | - |
| P1708_RS23895 (P1708_23895) | 26143..26448 | + | 306 | WP_023994167.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| P1708_RS23900 (P1708_23900) | 27198..27461 | + | 264 | WP_023994165.1 | DUF977 family protein | - |
| P1708_RS23905 (P1708_23905) | 27487..27822 | + | 336 | WP_023994164.1 | hypothetical protein | - |
| P1708_RS23910 (P1708_23910) | 28044..28241 | - | 198 | Protein_27 | PIN domain-containing protein | - |
| P1708_RS23915 (P1708_23915) | 28365..28454 | + | 90 | WP_071790431.1 | helix-turn-helix domain-containing protein | - |
| P1708_RS23920 (P1708_23920) | 28610..28894 | + | 285 | WP_001195098.1 | DUF1778 domain-containing protein | Antitoxin |
| P1708_RS23925 (P1708_23925) | 28885..29367 | + | 483 | WP_023994162.1 | GNAT family N-acetyltransferase | Toxin |
| P1708_RS23930 (P1708_23930) | 29682..30108 | + | 427 | Protein_31 | transposase | - |
| P1708_RS23935 (P1708_23935) | 30425..30634 | + | 210 | WP_023994160.1 | hemolysin expression modulator Hha | - |
| P1708_RS23940 (P1708_23940) | 30708..31060 | - | 353 | Protein_33 | transposase | - |
| P1708_RS23945 (P1708_23945) | 31287..32260 | + | 974 | Protein_34 | IS256 family transposase | - |
| P1708_RS23950 (P1708_23950) | 32262..32504 | + | 243 | WP_023994156.1 | hypothetical protein | - |
| P1708_RS23955 (P1708_23955) | 32575..33531 | + | 957 | WP_023994155.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| P1708_RS23960 (P1708_23960) | 33590..33802 | + | 213 | WP_023994154.1 | hypothetical protein | - |
| P1708_RS23965 (P1708_23965) | 33844..34095 | - | 252 | WP_023994153.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / qacE / sul1 / tet(A) / dfrA14 | faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..285070 | 285070 | |
| - | inside | IScluster/Tn | - | - | 23155..35659 | 12504 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17971.54 Da Isoelectric Point: 6.8521
>T274830 WP_023994162.1 NZ_CP120344:28885-29367 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MEISVTAPELLNEEHYLQQFDCGNDVLSDWLRRRAMKNQYLNASRTFVICPEGTKRVVGYYSIATGSVSHASLGRSLRQN
MPDPVPVVLLGRLAVDECTQGHSFGKWLLNDAVTRVSNLADQVGIKAIMVHAIDEQAKTFYEYFGFVQSPIAPNTLFYKI
MEISVTAPELLNEEHYLQQFDCGNDVLSDWLRRRAMKNQYLNASRTFVICPEGTKRVVGYYSIATGSVSHASLGRSLRQN
MPDPVPVVLLGRLAVDECTQGHSFGKWLLNDAVTRVSNLADQVGIKAIMVHAIDEQAKTFYEYFGFVQSPIAPNTLFYKI
Download Length: 483 bp
Antitoxin
Download Length: 95 a.a. Molecular weight: 10964.52 Da Isoelectric Point: 9.6539
>AT274830 WP_001195098.1 NZ_CP120344:28610-28894 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MQTTIRKSVRNKQINIRATDEERAVIDYAASLVSKNRTDFIIEKAVSEAQNIILDQRVFVLDDARYQAFIKQLEAPVQNT
EGRQRLMDVKPEWK
MQTTIRKSVRNKQINIRATDEERAVIDYAASLVSKNRTDFIIEKAVSEAQNIILDQRVFVLDDARYQAFIKQLEAPVQNT
EGRQRLMDVKPEWK
Download Length: 285 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A241PXX4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A727Z1I8 |