Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 4216528..4217044 Replicon chromosome
Accession NZ_CP120343
Organism Salmonella enterica subsp. enterica serovar Paratyphi B strain PS_Mu_4_2021

Toxin (Protein)


Gene name relE Uniprot ID C0Q7A9
Locus tag P1708_RS20750 Protein ID WP_000220578.1
Coordinates 4216528..4216812 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V7ISI8
Locus tag P1708_RS20755 Protein ID WP_000212724.1
Coordinates 4216802..4217044 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1708_RS20735 (4211644) 4211644..4213296 + 1653 WP_021294549.1 alpha,alpha-phosphotrehalase -
P1708_RS20740 (4213705) 4213705..4215843 + 2139 WP_000187818.1 anaerobic ribonucleoside-triphosphate reductase -
P1708_RS20745 (4216060) 4216060..4216524 + 465 WP_001009173.1 anaerobic ribonucleoside-triphosphate reductase-activating protein -
P1708_RS20750 (4216528) 4216528..4216812 - 285 WP_000220578.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P1708_RS20755 (4216802) 4216802..4217044 - 243 WP_000212724.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
P1708_RS20760 (4217122) 4217122..4219035 - 1914 WP_001212145.1 BglG family transcription antiterminator -
P1708_RS20765 (4219052) 4219052..4219792 - 741 WP_000779259.1 KDGP aldolase family protein -
P1708_RS20770 (4219789) 4219789..4220907 - 1119 WP_023197793.1 DgaE family pyridoxal phosphate-dependent ammonia lyase -
P1708_RS20775 (4220891) 4220891..4222024 - 1134 WP_017465838.1 amidohydrolase/deacetylase family metallohydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-83)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-80)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10854.67 Da        Isoelectric Point: 10.0482

>T274826 WP_000220578.1 NZ_CP120343:c4216812-4216528 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.34 Da        Isoelectric Point: 5.0651

>AT274826 WP_000212724.1 NZ_CP120343:c4217044-4216802 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MATLNVRLDDKLKNEAYAVLEKLNITPTEAVRLLFQYVAETGRMPVKTVTLSDSEDALIQTVRERLSSPQKGIKVSLDDL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3Z1E876

Antitoxin

Source ID Structure
AlphaFold DB A0A5H5JRI5

References