Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3521663..3522283 | Replicon | chromosome |
Accession | NZ_CP120343 | ||
Organism | Salmonella enterica subsp. enterica serovar Paratyphi B strain PS_Mu_4_2021 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P1708_RS17510 | Protein ID | WP_001280991.1 |
Coordinates | 3522065..3522283 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P1708_RS17505 | Protein ID | WP_000344807.1 |
Coordinates | 3521663..3522037 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1708_RS17495 (3516802) | 3516802..3517995 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P1708_RS17500 (3518018) | 3518018..3521167 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
P1708_RS17505 (3521663) | 3521663..3522037 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P1708_RS17510 (3522065) | 3522065..3522283 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P1708_RS17515 (3522462) | 3522462..3523013 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
P1708_RS17520 (3523130) | 3523130..3523600 | + | 471 | WP_000136181.1 | YlaC family protein | - |
P1708_RS17525 (3523656) | 3523656..3523796 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P1708_RS17530 (3523802) | 3523802..3524062 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
P1708_RS17535 (3524287) | 3524287..3525837 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
P1708_RS17545 (3526068) | 3526068..3526457 | + | 390 | WP_000961285.1 | MGMT family protein | - |
P1708_RS17550 (3526490) | 3526490..3527059 | - | 570 | WP_020437370.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T274822 WP_001280991.1 NZ_CP120343:3522065-3522283 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT274822 WP_000344807.1 NZ_CP120343:3521663-3522037 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|