Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1017312..1018126 | Replicon | chromosome |
Accession | NZ_CP120343 | ||
Organism | Salmonella enterica subsp. enterica serovar Paratyphi B strain PS_Mu_4_2021 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | P1708_RS04905 | Protein ID | WP_000971655.1 |
Coordinates | 1017312..1017839 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | P1708_RS04910 | Protein ID | WP_000855694.1 |
Coordinates | 1017836..1018126 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1708_RS04875 (1013612) | 1013612..1014009 | + | 398 | Protein_955 | cytoplasmic protein | - |
P1708_RS04880 (1014200) | 1014200..1014439 | + | 240 | Protein_956 | hypothetical protein | - |
P1708_RS04885 (1014596) | 1014596..1015264 | + | 669 | WP_000445914.1 | hypothetical protein | - |
P1708_RS04890 (1015291) | 1015291..1015785 | + | 495 | WP_000424942.1 | hypothetical protein | - |
P1708_RS04895 (1016030) | 1016030..1016686 | - | 657 | WP_020437799.1 | protein-serine/threonine phosphatase | - |
P1708_RS04900 (1017024) | 1017024..1017239 | + | 216 | Protein_960 | IS5/IS1182 family transposase | - |
P1708_RS04905 (1017312) | 1017312..1017839 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
P1708_RS04910 (1017836) | 1017836..1018126 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
P1708_RS04915 (1018396) | 1018396..1018596 | - | 201 | Protein_963 | transposase | - |
P1708_RS04920 (1018837) | 1018837..1019163 | + | 327 | WP_000393302.1 | hypothetical protein | - |
P1708_RS04925 (1019436) | 1019436..1019783 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
P1708_RS04930 (1019768) | 1019768..1020217 | - | 450 | WP_021294302.1 | hypothetical protein | - |
P1708_RS04935 (1020649) | 1020649..1021092 | - | 444 | WP_001522905.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
P1708_RS04940 (1021548) | 1021548..1022198 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1017099..1017239 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T274817 WP_000971655.1 NZ_CP120343:c1017839-1017312 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT274817 WP_000855694.1 NZ_CP120343:c1018126-1017836 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |