Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4488122..4488738 Replicon chromosome
Accession NZ_CP120341
Organism Salmonella enterica subsp. enterica serovar Muenchen strain PS_PB_1_2021

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag P1831_RS21560 Protein ID WP_000238494.1
Coordinates 4488122..4488496 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag P1831_RS21565 Protein ID WP_001523745.1
Coordinates 4488496..4488738 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1831_RS21545 (4485624) 4485624..4486526 + 903 WP_000331361.1 formate dehydrogenase subunit beta -
P1831_RS21550 (4486523) 4486523..4487158 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
P1831_RS21555 (4487155) 4487155..4488084 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
P1831_RS21560 (4488122) 4488122..4488496 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
P1831_RS21565 (4488496) 4488496..4488738 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
P1831_RS21570 (4488943) 4488943..4489872 + 930 WP_053445360.1 alpha/beta hydrolase -
P1831_RS21575 (4489958) 4489958..4490269 + 312 WP_060598552.1 type II toxin-antitoxin system HigB family toxin -
P1831_RS21580 (4490266) 4490266..4490712 + 447 WP_001259012.1 type II toxin-antitoxin system HigA family antitoxin -
P1831_RS21585 (4490727) 4490727..4491668 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
P1831_RS21590 (4491713) 4491713..4492150 - 438 WP_000560974.1 D-aminoacyl-tRNA deacylase -
P1831_RS21595 (4492147) 4492147..4493019 - 873 WP_000921423.1 virulence factor BrkB family protein -
P1831_RS21600 (4493013) 4493013..4493612 - 600 WP_000965698.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T274813 WP_000238494.1 NZ_CP120341:c4488496-4488122 [Salmonella enterica subsp. enterica serovar Muenchen]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT274813 WP_001523745.1 NZ_CP120341:c4488738-4488496 [Salmonella enterica subsp. enterica serovar Muenchen]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References