Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4082895..4083411 | Replicon | chromosome |
| Accession | NZ_CP120341 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_PB_1_2021 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | P1831_RS19695 | Protein ID | WP_000220578.1 |
| Coordinates | 4082895..4083179 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | P1831_RS19700 | Protein ID | WP_000212724.1 |
| Coordinates | 4083169..4083411 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1831_RS19680 (4078107) | 4078107..4079759 | + | 1653 | WP_000155045.1 | alpha,alpha-phosphotrehalase | - |
| P1831_RS19685 (4080168) | 4080168..4082306 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| P1831_RS19690 (4082427) | 4082427..4082891 | + | 465 | WP_053445439.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| P1831_RS19695 (4082895) | 4082895..4083179 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P1831_RS19700 (4083169) | 4083169..4083411 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P1831_RS19705 (4083489) | 4083489..4085402 | - | 1914 | WP_053445438.1 | BglG family transcription antiterminator | - |
| P1831_RS19710 (4085419) | 4085419..4086159 | - | 741 | WP_053445437.1 | KDGP aldolase family protein | - |
| P1831_RS19715 (4086156) | 4086156..4087274 | - | 1119 | WP_001139178.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| P1831_RS19720 (4087258) | 4087258..4088391 | - | 1134 | WP_053445436.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T274812 WP_000220578.1 NZ_CP120341:c4083179-4082895 [Salmonella enterica subsp. enterica serovar Muenchen]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |