Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2353139..2353661 | Replicon | chromosome |
Accession | NZ_CP120341 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_PB_1_2021 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A3Y0CYW1 |
Locus tag | P1831_RS11515 | Protein ID | WP_053445270.1 |
Coordinates | 2353139..2353423 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | P1831_RS11520 | Protein ID | WP_000885424.1 |
Coordinates | 2353413..2353661 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1831_RS11490 (2348295) | 2348295..2349536 | - | 1242 | WP_001095738.1 | MFS transporter | - |
P1831_RS11495 (2349526) | 2349526..2351034 | - | 1509 | WP_053445272.1 | FAD-dependent oxidoreductase | - |
P1831_RS11500 (2351079) | 2351079..2351567 | + | 489 | WP_023258342.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
P1831_RS11505 (2351760) | 2351760..2352839 | + | 1080 | WP_053445271.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
P1831_RS11510 (2352939) | 2352939..2353091 | - | 153 | Protein_2252 | Rid family hydrolase | - |
P1831_RS11515 (2353139) | 2353139..2353423 | - | 285 | WP_053445270.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P1831_RS11520 (2353413) | 2353413..2353661 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P1831_RS11525 (2354187) | 2354187..2354519 | + | 333 | WP_053445269.1 | DUF1493 family protein | - |
P1831_RS11530 (2354808) | 2354808..2355089 | - | 282 | WP_001580000.1 | hypothetical protein | - |
P1831_RS11535 (2355377) | 2355377..2356843 | - | 1467 | WP_077248432.1 | hypothetical protein | - |
P1831_RS11540 (2357101) | 2357101..2358108 | + | 1008 | WP_053445268.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11074.91 Da Isoelectric Point: 10.8165
>T274810 WP_053445270.1 NZ_CP120341:c2353423-2353139 [Salmonella enterica subsp. enterica serovar Muenchen]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRKRLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRKRLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Y0CYW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |