Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4216553..4217069 | Replicon | chromosome |
Accession | NZ_CP120339 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_5_2021 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | P1826_RS20760 | Protein ID | WP_000220578.1 |
Coordinates | 4216553..4216837 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | P1826_RS20765 | Protein ID | WP_000212724.1 |
Coordinates | 4216827..4217069 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1826_RS20745 (4211669) | 4211669..4213321 | + | 1653 | WP_021294549.1 | alpha,alpha-phosphotrehalase | - |
P1826_RS20750 (4213730) | 4213730..4215868 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
P1826_RS20755 (4216085) | 4216085..4216549 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
P1826_RS20760 (4216553) | 4216553..4216837 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P1826_RS20765 (4216827) | 4216827..4217069 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P1826_RS20770 (4217147) | 4217147..4219060 | - | 1914 | WP_001212145.1 | BglG family transcription antiterminator | - |
P1826_RS20775 (4219077) | 4219077..4219817 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
P1826_RS20780 (4219814) | 4219814..4220932 | - | 1119 | WP_023197793.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
P1826_RS20785 (4220916) | 4220916..4222049 | - | 1134 | WP_017465838.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T274795 WP_000220578.1 NZ_CP120339:c4216837-4216553 [Salmonella enterica subsp. enterica serovar Muenchen]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |