Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3521685..3522305 | Replicon | chromosome |
| Accession | NZ_CP120339 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_5_2021 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | P1826_RS17525 | Protein ID | WP_001280991.1 |
| Coordinates | 3522087..3522305 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | P1826_RS17520 | Protein ID | WP_000344807.1 |
| Coordinates | 3521685..3522059 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1826_RS17510 (3516824) | 3516824..3518017 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| P1826_RS17515 (3518040) | 3518040..3521189 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| P1826_RS17520 (3521685) | 3521685..3522059 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| P1826_RS17525 (3522087) | 3522087..3522305 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| P1826_RS17530 (3522484) | 3522484..3523035 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| P1826_RS17535 (3523152) | 3523152..3523622 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| P1826_RS17540 (3523678) | 3523678..3523818 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| P1826_RS17545 (3523824) | 3523824..3524084 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| P1826_RS17550 (3524309) | 3524309..3525859 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| P1826_RS17560 (3526090) | 3526090..3526479 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| P1826_RS17565 (3526512) | 3526512..3527081 | - | 570 | WP_020437370.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T274792 WP_001280991.1 NZ_CP120339:3522087-3522305 [Salmonella enterica subsp. enterica serovar Muenchen]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT274792 WP_000344807.1 NZ_CP120339:3521685-3522059 [Salmonella enterica subsp. enterica serovar Muenchen]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|